Shewanella alkalitolerans: K0J45_08145 Help Entry K0J45_08145       CDS       T09228                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shns  Shewanella alkalitolerans Pathway shns01100   Metabolic pathways shns01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shns00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K0J45_08145 (acpP)    00074 Mycolic acid biosynthesis     K0J45_08145 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K0J45_08145 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB Motif Other DBs NCBI-ProteinID:  QYJ99153 LinkDB All DBs Position 1799392..1799625 Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIIIEQLGVKEEDVKPAASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVSKNQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgtgtaaagaaaatcattatcgagcaactgggcgttaaagaa gaagacgtaaaaccagcagcatctttcgttgacgacctaggtgcagattctctggacacc gttgagttggtaatggctctagaagaagagtttgacactgagatccctgatgaagaagct gaaaagatcactactgttcaagcagcgatcgattacgtttctaagaatcagtaa

DBGET integrated database retrieval system