KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_0107
Entry
SHJGH_0107        CDS       T02531                                 
Name
(GenBank) aminotransferase
  KO
K20435  validone 7-phosphate aminotransferase [EC:2.6.1.-]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
sho00525  Acarbose and validamycin biosynthesis
sho01100  Metabolic pathways
sho01110  Biosynthesis of secondary metabolites
Module
sho_M00815  Validamycin A biosynthesis, sedoheptulopyranose-7P => validamycin A
Brite
KEGG Orthology (KO) [BR:sho00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    SHJGH_0107
Enzymes [BR:sho01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-
     SHJGH_0107
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: AGF59773
LinkDB
Position
complement(137380..138654)
AA seq 424 aa
MATTKRLPAPQDAAQYQLGDITLVRGEGIRAWDAEGREFLDCVSGTFNLLLGHNHPEVMA
AVREQTERLVFASSSFQTEPTNRVIQELAAISPPNLTRVNLRSSGGSTANEGAIKMAQLH
TGRRDVIVPFRAHLGQSLATASLNGTTKMRAPFPHRYPGGLHVPGPYCFRCFYRQTPETC
GMLCVDRIEDFITYASSGSVACVVIEPISGAGGNIVPPDGYLQELRRFCDEREIVLIFDE
IQTGLGRTGQMFAADHFGVQPHMMTLAKGLTGSGLPMAAILTEERMADWDRSLHSFTYGS
HTLSAAAALATLEIVQRPGFLENVRASGDVLLGRLRDLQKDNPVIGDVRGVGLMLGVELV
EPDGSKAVARAHAYQRSLQDHGILTRVSEHGEGSTIELRPPLILTPADAHMVADRFGEAL
EGIA
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggcaacgacgaaacgcctccctgcgccgcaggacgcggctcagtaccagctcggcgat
atcacgctggtgcgcggcgaaggcatccgtgcctgggatgccgaggggcgagagtttctc
gactgcgtctcgggcaccttcaacctactgctcggacacaaccacccagaggtgatggcc
gccgtacgggagcagaccgagcggctcgtcttcgccagctcgtccttccagaccgaaccc
accaaccgggtcatccaagaactggccgccatcagcccgcccaacctcacgcgggtcaac
ctgcgcagctccggtggctccaccgccaacgaaggcgccatcaagatggcccagctccat
accggtcgccgcgatgtcatcgtgccgttccgtgcccacctcggtcagagcctcgcgacg
gccagcctcaacggcaccacgaagatgcgcgcacccttcccgcaccggtatcccggcggc
cttcacgtgccaggcccttactgcttccgctgcttctaccgccagactcccgagacctgc
gggatgctctgtgtcgaccgcatcgaggacttcatcacctatgccagctccggcagcgtg
gcctgcgtagtgatcgagccgatcagcggtgccggcggtaacatcgtcccacccgacggt
taccttcaggagctgcgccggttctgcgacgagcgtgagatcgtcctcatcttcgacgag
atccagaccgggctgggccgcactggacagatgttcgctgccgaccacttcggcgtgcag
ccacacatgatgaccctcgccaagggactcaccggcagtggccttccgatggccgccatc
ctcaccgaagaacgtatggccgactgggaccgtagcctgcacagtttcacctatggcagc
cacaccctgtcggccgcggccgccctggccacgctggagatcgtccagcgacccggcttc
ctggagaacgtacgagccagcggcgatgtgctcctcggccggctgcgagacctccagaag
gacaaccccgtgatcggcgacgtccgaggggtcgggctgatgctcggggtggaactggtg
gagcccgacggttccaaggccgtcgcccgcgcccacgcctaccagcggtcgctccaggac
catggcatcctcacgcgcgtctccgagcacggagagggcagtacgatcgagctgcgtccc
cctctcatcctgacgcccgcagacgcccacatggtcgccgaccgcttcggcgaggcgctg
gagggcatcgcgtga

DBGET integrated database retrieval system