Staphylococcus hominis: EGX58_00625 Help Entry EGX58_00625       CDS       T06045                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shom  Staphylococcus hominis Pathway shom01100   Metabolic pathways shom01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shom00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EGX58_00625    00074 Mycolic acid biosynthesis     EGX58_00625   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EGX58_00625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L50 Ribosomal_L12_N HLH Motif Other DBs NCBI-ProteinID:  AYY65486 LinkDB All DBs Position complement(101019..101252) Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVKYINSLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgataaagtaaaagatatcatcgttgaccgtttaggtgtagacgctgat aaagtaacagaagatgcatctttcaaagatgatttaggcgctgactcacttgatatcgct gaattagtgatggaattagaagacgaatttggtactgaaattcctgatgaagaagctgaa aaaatcaacactgttggtgatgcagttaaatacatcaatagtcttgaaaaataa

DBGET integrated database retrieval system