Sturnira hondurensis: 118975065 Help Entry 118975065         CDS       T07222                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism shon  Sturnira hondurensis Pathway shon04140   Autophagy - animal shon04144   Endocytosis shon04152   AMPK signaling pathway shon04530   Tight junction shon04972   Pancreatic secretion shon05014   Amyotrophic lateral sclerosis shon05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     118975065 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118975065 (RAB8A)    04140 Autophagy - animal     118975065 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     118975065 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     118975065 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     118975065 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     118975065 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shon04131]     118975065 (RAB8A)    03036 Chromosome and associated proteins [BR:shon03036]     118975065 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shon04147]     118975065 (RAB8A)    04031 GTP-binding proteins [BR:shon04031]     118975065 (RAB8A) Membrane trafficking [BR:shon04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     118975065 (RAB8A)  Autophagy   Other autophagy associated proteins     118975065 (RAB8A) Chromosome and associated proteins [BR:shon03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     118975065 (RAB8A) Exosome [BR:shon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118975065 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    118975065 (RAB8A)   Exosomal proteins of colorectal cancer cells    118975065 (RAB8A) GTP-binding proteins [BR:shon04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     118975065 (RAB8A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 Septin DUF3963 AAA_7 Motif Other DBs NCBI-GeneID:  118975065 NCBI-ProteinID:  XP_036884593 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNEKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKKTSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccactttcatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaaactacag atatgggacacagctggccaggaacggtttcggacgatcacaacggcctactacaggggc gcaatgggcatcatgctggtctatgacatcaccaatgagaagtcctttgacaacatccgg aactggattcggaacattgaggagcatgcctctgcagatgtcgaaaagatgatacttggg aacaagtgtgacgtgaatgagaagagacaagtgtccaaggaacggggagagaagctggcc ctggactatggcatcaagttcatggagaccagtgcaaaagccaacatcaatgtggagaac gcattcttcactctcgccagagacatcaaagcaaaaatggacaaaaaattggaaggcaac agcccccaggggagcaaccagggagtcaaaatcacaccggaccagcagaagaagaccagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system