Sturnira hondurensis: 118977912 Help Entry 118977912         CDS       T07222                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism shon  Sturnira hondurensis Pathway shon04613   Neutrophil extracellular trap formation shon05034   Alcoholism shon05203   Viral carcinogenesis shon05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:shon00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     118977912  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     118977912   09163 Immune disease    05322 Systemic lupus erythematosus     118977912   09165 Substance dependence    05034 Alcoholism     118977912  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:shon03036]     118977912 Chromosome and associated proteins [BR:shon03036]  Eukaryotic type   Nucleosome assembly factors    Histones     118977912 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  118977912 NCBI-ProteinID:  XP_036888986 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgtggtaaaggcgggaagggtctcggaaaaggcggcgccaagcggcaccgc aaggtgctgcgcgacaacatccaaggcatcaccaagcccgccatccggcgcctggcccgc cgcggcggcgtgaagcgcatctccgggctcatctacgaggagacccgcggggtgctcaag gtcttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggtcgcaccctctacggc ttcggcggctga

DBGET integrated database retrieval system