Sturnira hondurensis: 118978330 Help Entry 118978330         CDS       T07222                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism shon  Sturnira hondurensis Pathway shon04137   Mitophagy - animal shon04140   Autophagy - animal shon04144   Endocytosis shon04145   Phagosome shon04148   Efferocytosis shon05132   Salmonella infection shon05146   Amoebiasis shon05152   Tuberculosis Brite KEGG Orthology (KO) [BR:shon00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118978330 (RAB7A)    04145 Phagosome     118978330 (RAB7A)    04140 Autophagy - animal     118978330 (RAB7A)    04137 Mitophagy - animal     118978330 (RAB7A)    04148 Efferocytosis     118978330 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118978330 (RAB7A)    05152 Tuberculosis     118978330 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     118978330 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shon04131]     118978330 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shon04147]     118978330 (RAB7A)    04031 GTP-binding proteins [BR:shon04031]     118978330 (RAB7A) Membrane trafficking [BR:shon04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     118978330 (RAB7A) Exosome [BR:shon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118978330 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    118978330 (RAB7A)   Exosomal proteins of colorectal cancer cells    118978330 (RAB7A)   Exosomal proteins of bladder cancer cells    118978330 (RAB7A) GTP-binding proteins [BR:shon04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     118978330 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  118978330 NCBI-ProteinID:  XP_036889634 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaagttatcatcctgggagattctggagtcggt aagacatcactcatgaaccagtatgtgaacaagaaattcagtaatcagtacaaagccaca ataggagcagactttctgacaaaggaggtgatggtggatgacagactagttacaatgcag atctgggacacagcaggacaggaacggttccaatctcttggtgtggccttctacagaggt gcagactgctgtgttctggtatttgatgtgactgcccccaacacattcaaaacccttgat agttggagagatgagtttctcatccaggccagtcctcgagatcctgaaaactttcctttc gtggtgttgggaaacaagattgaccttgaaaatagacaagtggccacgaaacgagcacag gcctggtgctacagcaaaaacaacattccctactttgagaccagtgccaaggaggccatc aacgtggagcaggcattccagacaattgcacggaatgcacttaaacaggaaacggaggtg gagctgtacaatgaatttcctgaacccatcaaactggacaagaacgatcgggccaaagcc tcggcagaaagttgcagttgctga

DBGET integrated database retrieval system