Sturnira hondurensis: 118979707 Help Entry 118979707         CDS       T07222                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism shon  Sturnira hondurensis Pathway shon04621   NOD-like receptor signaling pathway shon05012   Parkinson disease shon05132   Salmonella infection shon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:shon00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     118979707 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118979707 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     118979707 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     118979707 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:shon03110]     118979707 (TXN) Chaperones and folding catalysts [BR:shon03110]  Protein folding catalysts   Protein disulfide isomerase    118979707 (TXN) SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_8 DIM1 A6-like_Thioredoxin-like_C OST3_OST6 Thioredoxin_9 AhpC-TSA Thioredoxin_7 Glutaredoxin PedC-like Redoxin Motif Other DBs NCBI-GeneID:  118979707 NCBI-ProteinID:  XP_036891803 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKQIESKEAFQEALNSAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYTNVLFLEVDVD DCQDVASECEVKCMPTFQFFKRGKKVGEFSGANKEKLEATINEFV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcaaattgagagtaaggaagcattccaggaagccttgaacagtgcaggagat aaacttgtggtggtggacttctccgccacgtggtgtgggccttgcaaaatgatcaagcct ttttttcactccctctctgagaagtacaccaacgtgctgttcctggaggtcgatgtggat gactgtcaggatgttgcttcggagtgcgaagtcaaatgcatgccaaccttccagtttttt aaaagaggaaaaaaggtgggtgaattttccggagctaataaggaaaaacttgaagccacc atcaatgaatttgtttaa

DBGET integrated database retrieval system