Sturnira hondurensis: 118979747 Help Entry 118979747         CDS       T07222                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism shon  Sturnira hondurensis Pathway shon04010   MAPK signaling pathway shon04020   Calcium signaling pathway shon04022   cGMP-PKG signaling pathway shon04114   Oocyte meiosis shon04218   Cellular senescence shon04310   Wnt signaling pathway shon04360   Axon guidance shon04370   VEGF signaling pathway shon04380   Osteoclast differentiation shon04625   C-type lectin receptor signaling pathway shon04650   Natural killer cell mediated cytotoxicity shon04658   Th1 and Th2 cell differentiation shon04659   Th17 cell differentiation shon04660   T cell receptor signaling pathway shon04662   B cell receptor signaling pathway shon04720   Long-term potentiation shon04724   Glutamatergic synapse shon04921   Oxytocin signaling pathway shon04922   Glucagon signaling pathway shon04924   Renin secretion shon05010   Alzheimer disease shon05014   Amyotrophic lateral sclerosis shon05020   Prion disease shon05022   Pathways of neurodegeneration - multiple diseases shon05031   Amphetamine addiction shon05152   Tuberculosis shon05163   Human cytomegalovirus infection shon05166   Human T-cell leukemia virus 1 infection shon05167   Kaposi sarcoma-associated herpesvirus infection shon05170   Human immunodeficiency virus 1 infection shon05235   PD-L1 expression and PD-1 checkpoint pathway in cancer shon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118979747 (PPP3R2)    04310 Wnt signaling pathway     118979747 (PPP3R2)    04370 VEGF signaling pathway     118979747 (PPP3R2)    04020 Calcium signaling pathway     118979747 (PPP3R2)    04022 cGMP-PKG signaling pathway     118979747 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     118979747 (PPP3R2)    04218 Cellular senescence     118979747 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118979747 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     118979747 (PPP3R2)    04660 T cell receptor signaling pathway     118979747 (PPP3R2)    04658 Th1 and Th2 cell differentiation     118979747 (PPP3R2)    04659 Th17 cell differentiation     118979747 (PPP3R2)    04662 B cell receptor signaling pathway     118979747 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     118979747 (PPP3R2)    04921 Oxytocin signaling pathway     118979747 (PPP3R2)    04924 Renin secretion     118979747 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     118979747 (PPP3R2)    04720 Long-term potentiation     118979747 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     118979747 (PPP3R2)    04380 Osteoclast differentiation     118979747 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     118979747 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     118979747 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     118979747 (PPP3R2)    05163 Human cytomegalovirus infection     118979747 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     118979747 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     118979747 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     118979747 (PPP3R2)    05014 Amyotrophic lateral sclerosis     118979747 (PPP3R2)    05020 Prion disease     118979747 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     118979747 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     118979747 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118979747 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:shon01009]     118979747 (PPP3R2) Protein phosphatases and associated proteins [BR:shon01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      118979747 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg YtfJ_HI0045 flgK_1st_1 Motif Other DBs NCBI-GeneID:  118979747 NCBI-ProteinID:  XP_036891860 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPVEMCSHFNHDEIKRLGKRFKKLDLDSSGALSVNEFMSLPELQKNPLVQRVIE VFDTDGNGEVNFEEFIMGTSQFSVKGDEEQKLRFAFRIYDMDKDGYISNGELFQVLHMMV GGSLKDWKLQQLVDKTIITLDRDGDGKISFEEFRAAVGGLEVHKQLVAAV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggcaatgaggccagctaccccgtggagatgtgctcccactttaaccatgacgaaatt aaaaggctgggcaagaggtttaagaagctggacttggactcttcgggtgccctgagcgtg aacgagttcatgtcccttcccgagctgcagaagaacccgttggtgcagcgagtgatcgag gtttttgacaccgacggcaacggagaggtgaacttcgaggaattcatcatggggacctcc cagttcagtgtcaagggagacgaggagcagaagctgaggtttgcgttccgcatctacgac atggataaagacgggtacatctccaacggggagctcttccaggtgttacacatgatggtg gggggcagcctgaaagactggaagctccagcagctcgtggacaaaaccatcatcaccctg gacagggacggcgacgggaaaatatccttcgaggagttccgagctgccgtggggggcttg gaggtgcacaagcagttggtggccgctgtgtga

DBGET integrated database retrieval system