Sturnira hondurensis: 118981660 Help Entry 118981660         CDS       T07222                                  Symbol CCL28 Name (RefSeq) C-C motif chemokine 28   KO K05513   C-C motif chemokine 28 Organism shon  Sturnira hondurensis Pathway shon04060   Cytokine-cytokine receptor interaction shon04061   Viral protein interaction with cytokine and cytokine receptor shon04062   Chemokine signaling pathway shon04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118981660 (CCL28)    04061 Viral protein interaction with cytokine and cytokine receptor     118981660 (CCL28)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     118981660 (CCL28)    04062 Chemokine signaling pathway     118981660 (CCL28)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shon04052]     118981660 (CCL28) Cytokines and neuropeptides [BR:shon04052]  Cytokines   Chemokines    118981660 (CCL28) SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  118981660 NCBI-ProteinID:  XP_036894362 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MQQAGLALVALAAWVALYPSDAILPIASSCCTEVSQHISRRLLERVNVCRIQRADGDCDL AAVILHVKRRRICASPHSRIVKQWMKEQAGKRDAKGHICRRRRHHSQRSDRAARRPRGDR DRGHGAPSQRRPR NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgcagcaggcgggactggctctcgtggccttggctgcctgggtggctctttacccttca gacgccatacttcccattgcctccagctgctgcaccgaggtctcccagcatatctcccga aggcttctggagagagtgaatgtctgtcgcatccagagagctgatggggactgtgacttg gcggctgtcatcctgcacgtcaagcgcagaagaatctgtgccagcccgcacagtcgcatt gttaagcagtggatgaaagaacaagcaggcaagagagatgccaaaggtcacatctgccgc aggaggagacaccacagccagaggagcgatcgcgcggcccgccgtcccaggggggacaga gatcggggccacggagcgccttctcagaggcggcccagatga

DBGET integrated database retrieval system