KEGG   Sturnira hondurensis: 118981977
Entry
118981977         CDS       T07222                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
shon  Sturnira hondurensis
Pathway
shon01521  EGFR tyrosine kinase inhibitor resistance
shon01522  Endocrine resistance
shon04010  MAPK signaling pathway
shon04012  ErbB signaling pathway
shon04014  Ras signaling pathway
shon04015  Rap1 signaling pathway
shon04062  Chemokine signaling pathway
shon04068  FoxO signaling pathway
shon04071  Sphingolipid signaling pathway
shon04072  Phospholipase D signaling pathway
shon04137  Mitophagy - animal
shon04140  Autophagy - animal
shon04150  mTOR signaling pathway
shon04151  PI3K-Akt signaling pathway
shon04210  Apoptosis
shon04211  Longevity regulating pathway
shon04213  Longevity regulating pathway - multiple species
shon04218  Cellular senescence
shon04360  Axon guidance
shon04370  VEGF signaling pathway
shon04371  Apelin signaling pathway
shon04540  Gap junction
shon04550  Signaling pathways regulating pluripotency of stem cells
shon04625  C-type lectin receptor signaling pathway
shon04650  Natural killer cell mediated cytotoxicity
shon04660  T cell receptor signaling pathway
shon04662  B cell receptor signaling pathway
shon04664  Fc epsilon RI signaling pathway
shon04714  Thermogenesis
shon04720  Long-term potentiation
shon04722  Neurotrophin signaling pathway
shon04725  Cholinergic synapse
shon04726  Serotonergic synapse
shon04730  Long-term depression
shon04810  Regulation of actin cytoskeleton
shon04910  Insulin signaling pathway
shon04912  GnRH signaling pathway
shon04915  Estrogen signaling pathway
shon04916  Melanogenesis
shon04917  Prolactin signaling pathway
shon04919  Thyroid hormone signaling pathway
shon04921  Oxytocin signaling pathway
shon04926  Relaxin signaling pathway
shon04929  GnRH secretion
shon04933  AGE-RAGE signaling pathway in diabetic complications
shon04935  Growth hormone synthesis, secretion and action
shon05010  Alzheimer disease
shon05022  Pathways of neurodegeneration - multiple diseases
shon05034  Alcoholism
shon05160  Hepatitis C
shon05161  Hepatitis B
shon05163  Human cytomegalovirus infection
shon05165  Human papillomavirus infection
shon05166  Human T-cell leukemia virus 1 infection
shon05167  Kaposi sarcoma-associated herpesvirus infection
shon05170  Human immunodeficiency virus 1 infection
shon05200  Pathways in cancer
shon05203  Viral carcinogenesis
shon05205  Proteoglycans in cancer
shon05206  MicroRNAs in cancer
shon05207  Chemical carcinogenesis - receptor activation
shon05208  Chemical carcinogenesis - reactive oxygen species
shon05210  Colorectal cancer
shon05211  Renal cell carcinoma
shon05213  Endometrial cancer
shon05214  Glioma
shon05215  Prostate cancer
shon05216  Thyroid cancer
shon05218  Melanoma
shon05219  Bladder cancer
shon05220  Chronic myeloid leukemia
shon05221  Acute myeloid leukemia
shon05223  Non-small cell lung cancer
shon05224  Breast cancer
shon05225  Hepatocellular carcinoma
shon05226  Gastric cancer
shon05230  Central carbon metabolism in cancer
shon05231  Choline metabolism in cancer
shon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shon05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    118981977 (NRAS)
   04012 ErbB signaling pathway
    118981977 (NRAS)
   04014 Ras signaling pathway
    118981977 (NRAS)
   04015 Rap1 signaling pathway
    118981977 (NRAS)
   04370 VEGF signaling pathway
    118981977 (NRAS)
   04371 Apelin signaling pathway
    118981977 (NRAS)
   04068 FoxO signaling pathway
    118981977 (NRAS)
   04072 Phospholipase D signaling pathway
    118981977 (NRAS)
   04071 Sphingolipid signaling pathway
    118981977 (NRAS)
   04151 PI3K-Akt signaling pathway
    118981977 (NRAS)
   04150 mTOR signaling pathway
    118981977 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    118981977 (NRAS)
   04137 Mitophagy - animal
    118981977 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    118981977 (NRAS)
   04218 Cellular senescence
    118981977 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    118981977 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    118981977 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    118981977 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    118981977 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    118981977 (NRAS)
   04660 T cell receptor signaling pathway
    118981977 (NRAS)
   04662 B cell receptor signaling pathway
    118981977 (NRAS)
   04664 Fc epsilon RI signaling pathway
    118981977 (NRAS)
   04062 Chemokine signaling pathway
    118981977 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    118981977 (NRAS)
   04929 GnRH secretion
    118981977 (NRAS)
   04912 GnRH signaling pathway
    118981977 (NRAS)
   04915 Estrogen signaling pathway
    118981977 (NRAS)
   04917 Prolactin signaling pathway
    118981977 (NRAS)
   04921 Oxytocin signaling pathway
    118981977 (NRAS)
   04926 Relaxin signaling pathway
    118981977 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    118981977 (NRAS)
   04919 Thyroid hormone signaling pathway
    118981977 (NRAS)
   04916 Melanogenesis
    118981977 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    118981977 (NRAS)
   04726 Serotonergic synapse
    118981977 (NRAS)
   04720 Long-term potentiation
    118981977 (NRAS)
   04730 Long-term depression
    118981977 (NRAS)
   04722 Neurotrophin signaling pathway
    118981977 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    118981977 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    118981977 (NRAS)
   04213 Longevity regulating pathway - multiple species
    118981977 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    118981977 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118981977 (NRAS)
   05206 MicroRNAs in cancer
    118981977 (NRAS)
   05205 Proteoglycans in cancer
    118981977 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    118981977 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    118981977 (NRAS)
   05203 Viral carcinogenesis
    118981977 (NRAS)
   05230 Central carbon metabolism in cancer
    118981977 (NRAS)
   05231 Choline metabolism in cancer
    118981977 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    118981977 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    118981977 (NRAS)
   05225 Hepatocellular carcinoma
    118981977 (NRAS)
   05226 Gastric cancer
    118981977 (NRAS)
   05214 Glioma
    118981977 (NRAS)
   05216 Thyroid cancer
    118981977 (NRAS)
   05221 Acute myeloid leukemia
    118981977 (NRAS)
   05220 Chronic myeloid leukemia
    118981977 (NRAS)
   05218 Melanoma
    118981977 (NRAS)
   05211 Renal cell carcinoma
    118981977 (NRAS)
   05219 Bladder cancer
    118981977 (NRAS)
   05215 Prostate cancer
    118981977 (NRAS)
   05213 Endometrial cancer
    118981977 (NRAS)
   05224 Breast cancer
    118981977 (NRAS)
   05223 Non-small cell lung cancer
    118981977 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    118981977 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    118981977 (NRAS)
   05161 Hepatitis B
    118981977 (NRAS)
   05160 Hepatitis C
    118981977 (NRAS)
   05163 Human cytomegalovirus infection
    118981977 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    118981977 (NRAS)
   05165 Human papillomavirus infection
    118981977 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    118981977 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    118981977 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    118981977 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    118981977 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    118981977 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    118981977 (NRAS)
   01522 Endocrine resistance
    118981977 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shon04131]
    118981977 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shon04147]
    118981977 (NRAS)
   04031 GTP-binding proteins [BR:shon04031]
    118981977 (NRAS)
Membrane trafficking [BR:shon04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    118981977 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    118981977 (NRAS)
Exosome [BR:shon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   118981977 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   118981977 (NRAS)
  Exosomal proteins of breast cancer cells
   118981977 (NRAS)
  Exosomal proteins of colorectal cancer cells
   118981977 (NRAS)
GTP-binding proteins [BR:shon04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    118981977 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 118981977
NCBI-ProteinID: XP_036894762
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcgctgaca
atccagctaatccagaaccactttgtagatgaatatgaccccaccatagaggattcttac
cgaaaacaggtggttatagatggtgaaacctgtctgctggacatactggacacagctgga
caagaggagtacagtgccatgcgagaccagtacatgaggacaggcgaaggcttcctctgt
gtatttgctatcaataatagcaagtcattcgcagatattaacctgtacagagagcagatt
aagcgagtcaaagactcagatgatgtacctatggtgctagtgggaaacaagtgtgatttg
ccaacgagaacagttgacacaaaacaagcccacgaactggccaagagttacgggatcccg
ttcattgaaacctcagccaagaccagacagggtgtcgaagatgccttttacacactggtg
agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt
tgcatggggctgccctgcgtggtgatgtaa

DBGET integrated database retrieval system