Sturnira hondurensis: 118981977 Help Entry 118981977         CDS       T07222                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism shon  Sturnira hondurensis Pathway shon01521   EGFR tyrosine kinase inhibitor resistance shon01522   Endocrine resistance shon04010   MAPK signaling pathway shon04012   ErbB signaling pathway shon04014   Ras signaling pathway shon04015   Rap1 signaling pathway shon04062   Chemokine signaling pathway shon04068   FoxO signaling pathway shon04071   Sphingolipid signaling pathway shon04072   Phospholipase D signaling pathway shon04137   Mitophagy - animal shon04140   Autophagy - animal shon04150   mTOR signaling pathway shon04151   PI3K-Akt signaling pathway shon04210   Apoptosis shon04211   Longevity regulating pathway shon04213   Longevity regulating pathway - multiple species shon04218   Cellular senescence shon04360   Axon guidance shon04370   VEGF signaling pathway shon04371   Apelin signaling pathway shon04540   Gap junction shon04550   Signaling pathways regulating pluripotency of stem cells shon04625   C-type lectin receptor signaling pathway shon04650   Natural killer cell mediated cytotoxicity shon04660   T cell receptor signaling pathway shon04662   B cell receptor signaling pathway shon04664   Fc epsilon RI signaling pathway shon04714   Thermogenesis shon04720   Long-term potentiation shon04722   Neurotrophin signaling pathway shon04725   Cholinergic synapse shon04726   Serotonergic synapse shon04730   Long-term depression shon04810   Regulation of actin cytoskeleton shon04910   Insulin signaling pathway shon04912   GnRH signaling pathway shon04915   Estrogen signaling pathway shon04916   Melanogenesis shon04917   Prolactin signaling pathway shon04919   Thyroid hormone signaling pathway shon04921   Oxytocin signaling pathway shon04926   Relaxin signaling pathway shon04929   GnRH secretion shon04933   AGE-RAGE signaling pathway in diabetic complications shon04935   Growth hormone synthesis, secretion and action shon05010   Alzheimer disease shon05022   Pathways of neurodegeneration - multiple diseases shon05034   Alcoholism shon05160   Hepatitis C shon05161   Hepatitis B shon05163   Human cytomegalovirus infection shon05165   Human papillomavirus infection shon05166   Human T-cell leukemia virus 1 infection shon05167   Kaposi sarcoma-associated herpesvirus infection shon05170   Human immunodeficiency virus 1 infection shon05200   Pathways in cancer shon05203   Viral carcinogenesis shon05205   Proteoglycans in cancer shon05206   MicroRNAs in cancer shon05207   Chemical carcinogenesis - receptor activation shon05208   Chemical carcinogenesis - reactive oxygen species shon05210   Colorectal cancer shon05211   Renal cell carcinoma shon05213   Endometrial cancer shon05214   Glioma shon05215   Prostate cancer shon05216   Thyroid cancer shon05218   Melanoma shon05219   Bladder cancer shon05220   Chronic myeloid leukemia shon05221   Acute myeloid leukemia shon05223   Non-small cell lung cancer shon05224   Breast cancer shon05225   Hepatocellular carcinoma shon05226   Gastric cancer shon05230   Central carbon metabolism in cancer shon05231   Choline metabolism in cancer shon05235   PD-L1 expression and PD-1 checkpoint pathway in cancer shon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118981977 (NRAS)    04012 ErbB signaling pathway     118981977 (NRAS)    04014 Ras signaling pathway     118981977 (NRAS)    04015 Rap1 signaling pathway     118981977 (NRAS)    04370 VEGF signaling pathway     118981977 (NRAS)    04371 Apelin signaling pathway     118981977 (NRAS)    04068 FoxO signaling pathway     118981977 (NRAS)    04072 Phospholipase D signaling pathway     118981977 (NRAS)    04071 Sphingolipid signaling pathway     118981977 (NRAS)    04151 PI3K-Akt signaling pathway     118981977 (NRAS)    04150 mTOR signaling pathway     118981977 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118981977 (NRAS)    04137 Mitophagy - animal     118981977 (NRAS)   09143 Cell growth and death    04210 Apoptosis     118981977 (NRAS)    04218 Cellular senescence     118981977 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     118981977 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     118981977 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     118981977 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118981977 (NRAS)    04650 Natural killer cell mediated cytotoxicity     118981977 (NRAS)    04660 T cell receptor signaling pathway     118981977 (NRAS)    04662 B cell receptor signaling pathway     118981977 (NRAS)    04664 Fc epsilon RI signaling pathway     118981977 (NRAS)    04062 Chemokine signaling pathway     118981977 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     118981977 (NRAS)    04929 GnRH secretion     118981977 (NRAS)    04912 GnRH signaling pathway     118981977 (NRAS)    04915 Estrogen signaling pathway     118981977 (NRAS)    04917 Prolactin signaling pathway     118981977 (NRAS)    04921 Oxytocin signaling pathway     118981977 (NRAS)    04926 Relaxin signaling pathway     118981977 (NRAS)    04935 Growth hormone synthesis, secretion and action     118981977 (NRAS)    04919 Thyroid hormone signaling pathway     118981977 (NRAS)    04916 Melanogenesis     118981977 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     118981977 (NRAS)    04726 Serotonergic synapse     118981977 (NRAS)    04720 Long-term potentiation     118981977 (NRAS)    04730 Long-term depression     118981977 (NRAS)    04722 Neurotrophin signaling pathway     118981977 (NRAS)   09158 Development and regeneration    04360 Axon guidance     118981977 (NRAS)   09149 Aging    04211 Longevity regulating pathway     118981977 (NRAS)    04213 Longevity regulating pathway - multiple species     118981977 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     118981977 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118981977 (NRAS)    05206 MicroRNAs in cancer     118981977 (NRAS)    05205 Proteoglycans in cancer     118981977 (NRAS)    05207 Chemical carcinogenesis - receptor activation     118981977 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     118981977 (NRAS)    05203 Viral carcinogenesis     118981977 (NRAS)    05230 Central carbon metabolism in cancer     118981977 (NRAS)    05231 Choline metabolism in cancer     118981977 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     118981977 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     118981977 (NRAS)    05225 Hepatocellular carcinoma     118981977 (NRAS)    05226 Gastric cancer     118981977 (NRAS)    05214 Glioma     118981977 (NRAS)    05216 Thyroid cancer     118981977 (NRAS)    05221 Acute myeloid leukemia     118981977 (NRAS)    05220 Chronic myeloid leukemia     118981977 (NRAS)    05218 Melanoma     118981977 (NRAS)    05211 Renal cell carcinoma     118981977 (NRAS)    05219 Bladder cancer     118981977 (NRAS)    05215 Prostate cancer     118981977 (NRAS)    05213 Endometrial cancer     118981977 (NRAS)    05224 Breast cancer     118981977 (NRAS)    05223 Non-small cell lung cancer     118981977 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     118981977 (NRAS)    05170 Human immunodeficiency virus 1 infection     118981977 (NRAS)    05161 Hepatitis B     118981977 (NRAS)    05160 Hepatitis C     118981977 (NRAS)    05163 Human cytomegalovirus infection     118981977 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     118981977 (NRAS)    05165 Human papillomavirus infection     118981977 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     118981977 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     118981977 (NRAS)   09165 Substance dependence    05034 Alcoholism     118981977 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118981977 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     118981977 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     118981977 (NRAS)    01522 Endocrine resistance     118981977 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shon04131]     118981977 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shon04147]     118981977 (NRAS)    04031 GTP-binding proteins [BR:shon04031]     118981977 (NRAS) Membrane trafficking [BR:shon04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     118981977 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     118981977 (NRAS) Exosome [BR:shon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118981977 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    118981977 (NRAS)   Exosomal proteins of breast cancer cells    118981977 (NRAS)   Exosomal proteins of colorectal cancer cells    118981977 (NRAS) GTP-binding proteins [BR:shon04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     118981977 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  118981977 NCBI-ProteinID:  XP_036894762 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcgctgaca atccagctaatccagaaccactttgtagatgaatatgaccccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacctgtctgctggacatactggacacagctgga caagaggagtacagtgccatgcgagaccagtacatgaggacaggcgaaggcttcctctgt gtatttgctatcaataatagcaagtcattcgcagatattaacctgtacagagagcagatt aagcgagtcaaagactcagatgatgtacctatggtgctagtgggaaacaagtgtgatttg ccaacgagaacagttgacacaaaacaagcccacgaactggccaagagttacgggatcccg ttcattgaaacctcagccaagaccagacagggtgtcgaagatgccttttacacactggtg agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt tgcatggggctgccctgcgtggtgatgtaa

DBGET integrated database retrieval system