Sturnira hondurensis: 118982345 Help Entry 118982345         CDS       T07222                                  Name (RefSeq) ubiquitin-like   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism shon  Sturnira hondurensis Pathway shon03010   Ribosome shon04120   Ubiquitin mediated proteolysis shon04137   Mitophagy - animal shon04140   Autophagy - animal shon05012   Parkinson disease shon05022   Pathways of neurodegeneration - multiple diseases shon05167   Kaposi sarcoma-associated herpesvirus infection shon05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:shon00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     118982345   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     118982345  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118982345    04137 Mitophagy - animal     118982345  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     118982345    05167 Kaposi sarcoma-associated herpesvirus infection     118982345   09164 Neurodegenerative disease    05012 Parkinson disease     118982345    05022 Pathways of neurodegeneration - multiple diseases     118982345  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:shon03011]     118982345    04121 Ubiquitin system [BR:shon04121]     118982345   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shon04147]     118982345 Ribosome [BR:shon03011]  Ribosomal proteins   Eukaryotes    Small subunit     118982345   Archaea     118982345 Ubiquitin system [BR:shon04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    118982345 Exosome [BR:shon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118982345   Exosomal proteins of colorectal cancer cells    118982345 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ribosomal_S27 Rad60-SLD_2 Ubiquitin_2 TBK1_ULD Ubiquitin_5 Motif Other DBs NCBI-GeneID:  118982345 NCBI-ProteinID:  XP_036895284 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MQIVVKTLMGKTITLEVEPLDKIENLKAKIQDREGIPPDQQRLIFAGKQLEGGRTLSEYR IQKKSTLHLVLRLCGAKKRRKSYATLKKNKHKGKRAKLPVLKYHKVDENGKISCPRQECP SDKCGARVWWPTF NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgcagattgtagtgaaaactcttatggggaagaccatcactctcgaggttgaacccttg gataaaatagaaaatttaaaggccaagatccaggatagagaaggaattcctcctgatcaa caaagactgatctttgctggcaagcaactggaaggtggacgtactttgtctgagtaccgc attcaaaagaagtccactcttcatcttgtgttgagactttgtggtgctaagaaaaggagg aagtcttatgccactctgaagaagaataagcacaagggaaagagggctaagcttcctgtc ctgaaataccacaaagtggacgagaatggcaaaatcagttgccctcgtcaggagtgccct tcagataagtgcggtgccagagtctggtggcccaccttctga

DBGET integrated database retrieval system