Sturnira hondurensis: 118983291 Help Entry 118983291         CDS       T07222                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism shon  Sturnira hondurensis Pathway shon04024   cAMP signaling pathway shon04080   Neuroactive ligand-receptor interaction shon04081   Hormone signaling shon04935   Growth hormone synthesis, secretion and action shon04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     118983291 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     118983291 (SST)    04081 Hormone signaling     118983291 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     118983291 (SST)   09154 Digestive system    04971 Gastric acid secretion     118983291 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shon04052]     118983291 (SST) Cytokines and neuropeptides [BR:shon04052]  Neuropeptides   GPCR binding    118983291 (SST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  118983291 NCBI-ProteinID:  XP_036896536 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MLSCRLQYALAALSIVLALGGVTAAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSTNSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtacgcgctggccgcgctctccatcgtcctggctttgggc ggtgtcaccgccgcaccttcggatccccgactgcgtcagtttctgcagaagtctctggct gctgccgcggggaaacaggaactggccaagtacttcttggcagaactgctgtctgaaccc aaccagacagagaatgatgccctggaacctgaagatttgtcccaggctgctgagcaggat gaaatgaggctggagctgcagagatccaccaactcgaacccggctatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagacattcacgtcctgttag

DBGET integrated database retrieval system