Sturnira hondurensis: 118983957 Help Entry 118983957         CDS       T07222                                  Name (RefSeq) metallothionein-2-like   KO K14739   metallothionein 1/2 Organism shon  Sturnira hondurensis Pathway shon04978   Mineral absorption Brite KEGG Orthology (KO) [BR:shon00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     118983957  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:shon03019]     118983957    03029 Mitochondrial biogenesis [BR:shon03029]     118983957 Messenger RNA biogenesis [BR:shon03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      118983957 Mitochondrial biogenesis [BR:shon03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     118983957 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  118983957 NCBI-ProteinID:  XP_036897573 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPNCSCSTGDSCTCAGSCKCKDCKCTSCKKSCCACCPMGCAKCAQGCVCKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgctccactggcgactcctgcacctgtgccggctcctgcaaa tgcaaagactgcaaatgcacctcctgcaagaagagctgctgtgcctgctgccccatgggc tgtgccaagtgtgcccagggctgcgtctgcaaaggagcatcagacaagtgcagttgctgt gcatga

DBGET integrated database retrieval system