Sturnira hondurensis: 118983976 Help Entry 118983976         CDS       T07222                                  Symbol CCL17 Name (RefSeq) C-C motif chemokine 17   KO K21083   C-C motif chemokine 17 Organism shon  Sturnira hondurensis Pathway shon04060   Cytokine-cytokine receptor interaction shon04061   Viral protein interaction with cytokine and cytokine receptor shon04062   Chemokine signaling pathway shon04625   C-type lectin receptor signaling pathway shon04657   IL-17 signaling pathway Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118983976 (CCL17)    04061 Viral protein interaction with cytokine and cytokine receptor     118983976 (CCL17)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118983976 (CCL17)    04657 IL-17 signaling pathway     118983976 (CCL17)    04062 Chemokine signaling pathway     118983976 (CCL17)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shon04052]     118983976 (CCL17) Cytokines and neuropeptides [BR:shon04052]  Cytokines   Chemokines    118983976 (CCL17) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 DNMT1-RFD UL128 Motif Other DBs NCBI-GeneID:  118983976 NCBI-ProteinID:  XP_036897594 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MIPVKMLLLVTLLLGASLQDAHAARGTNVGRECCLEYFKGAVPVSRVVTWYHTPEECPKN AIVFVTRQGRYICMNPEDTKVKKAMKHLRKIMKSGDPSTQKS NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgatcccagtgaagatgctgctcctagtcaccctcctcctgggcgcttccctgcaggac gcccatgcagctcgagggaccaacgtgggcagggagtgctgcctggaatacttcaaaggg gctgtccctgtcagtagggtggtaacgtggtaccacaccccggaggagtgtcccaagaat gccattgtgtttgtgactcgccagggcaggtatatctgcatgaaccccgaggacaccaag gtgaagaaggcaatgaaacacttgcgaaaaatcatgaagtcaggtgaccccagcacccag aaatcctga

DBGET integrated database retrieval system