Sturnira hondurensis: 118984066 Help Entry 118984066         CDS       T07222                                  Name (RefSeq) interferon alpha-4-like   KO K05414   interferon alpha Organism shon  Sturnira hondurensis Pathway shon04060   Cytokine-cytokine receptor interaction shon04151   PI3K-Akt signaling pathway shon04217   Necroptosis shon04620   Toll-like receptor signaling pathway shon04621   NOD-like receptor signaling pathway shon04622   RIG-I-like receptor signaling pathway shon04623   Cytosolic DNA-sensing pathway shon04630   JAK-STAT signaling pathway shon04650   Natural killer cell mediated cytotoxicity shon04936   Alcoholic liver disease shon05152   Tuberculosis shon05160   Hepatitis C shon05161   Hepatitis B shon05162   Measles shon05163   Human cytomegalovirus infection shon05164   Influenza A shon05165   Human papillomavirus infection shon05167   Kaposi sarcoma-associated herpesvirus infection shon05168   Herpes simplex virus 1 infection shon05169   Epstein-Barr virus infection shon05170   Human immunodeficiency virus 1 infection shon05171   Coronavirus disease - COVID-19 shon05200   Pathways in cancer shon05320   Autoimmune thyroid disease shon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     118984066    04151 PI3K-Akt signaling pathway     118984066   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118984066  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     118984066  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     118984066    04621 NOD-like receptor signaling pathway     118984066    04622 RIG-I-like receptor signaling pathway     118984066    04623 Cytosolic DNA-sensing pathway     118984066    04650 Natural killer cell mediated cytotoxicity     118984066  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118984066   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     118984066    05161 Hepatitis B     118984066    05160 Hepatitis C     118984066    05171 Coronavirus disease - COVID-19     118984066    05164 Influenza A     118984066    05162 Measles     118984066    05168 Herpes simplex virus 1 infection     118984066    05163 Human cytomegalovirus infection     118984066    05167 Kaposi sarcoma-associated herpesvirus infection     118984066    05169 Epstein-Barr virus infection     118984066    05165 Human papillomavirus infection     118984066   09171 Infectious disease: bacterial    05152 Tuberculosis     118984066   09163 Immune disease    05320 Autoimmune thyroid disease     118984066   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118984066   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     118984066  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shon04052]     118984066 Cytokines and neuropeptides [BR:shon04052]  Cytokines   Interferons    118984066 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  118984066 NCBI-ProteinID:  XP_036897666 LinkDB All DBs Position Unknown AA seq 161 aa AA seqDB search MALTFSFLVALVALSCNSICSLGCDLPQTHSLVNGRALVLLGQMRRINTFFCLKDRNNFG FPLEALSGNQFQEAQASSAIHEIIWQIFNLFTTEGAFAAWNKTLLDQLCNELYQQLSDLE ACLMQEVGMEEAPLMSEDSFLAVRKYFQRIILYLQEKQHSP NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atggccctgaccttttccttcctggtggccctggtggcactcagctgcaactccatttgc tctctgggctgtgacctgcctcagacccacagcctggttaacgggagggccttggtgctc ctgggacaaatgagaaggatcaacactttcttctgcctgaaggacagaaacaactttggg ttccccctggaggcgctcagtggcaatcagttccaggaggctcaagccagttctgccatc catgagatcatctggcagattttcaacctcttcaccacagagggcgcgtttgctgcttgg aacaagaccctcctggaccaactctgcaatgaactttatcagcagctgagtgacctggaa gcctgtctgatgcaggaggtggggatggaagaggctcccctgatgagtgaggactccttc ctggctgtgaggaaatacttccagagaatcattctctacctgcaggagaagcagcacagc ccttga

DBGET integrated database retrieval system