Sturnira hondurensis: 118985104 Help Entry 118985104         CDS       T07222                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism shon  Sturnira hondurensis Pathway shon04066   HIF-1 signaling pathway shon04120   Ubiquitin mediated proteolysis shon05170   Human immunodeficiency virus 1 infection shon05200   Pathways in cancer shon05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:shon00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     118985104 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     118985104 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118985104 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     118985104 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     118985104 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:shon04121]     118985104 (ELOB)    03400 DNA repair and recombination proteins [BR:shon03400]     118985104 (ELOB) Ubiquitin system [BR:shon04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      118985104 (ELOB)    Cul5 complex      118985104 (ELOB) DNA repair and recombination proteins [BR:shon03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      118985104 (ELOB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  118985104 NCBI-ProteinID:  XP_036899338 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MPARCPQDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDG KTLGECGFTSQTARPQAPATVGLAFRADDAFEALRIEPFSSPPELPDVMKPQDSGSSANE QAVQ NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgccagcccgctgcccccaggacgtgttcctcatgatccggcgccataagactaccatc ttcacggatgccaaggagtcgagcaccgtgttcgagctgaagcgcatcgtcgagggcatc ctcaagcggccgccggacgagcagcggctatacaaggatgaccaacttctggatgacggc aagacactgggcgagtgtggcttcaccagtcaaacagctcggccacaggccccagccact gtggggctggccttccgggcagatgatgcatttgaggccctgcgcatcgagcctttctcc agccccccagagctgcctgatgtgatgaagccacaggactcaggaagcagtgccaatgaa caagctgtgcagtga

DBGET integrated database retrieval system