Sturnira hondurensis: 118986237 Help Entry 118986237         CDS       T07222                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism shon  Sturnira hondurensis Pathway shon04613   Neutrophil extracellular trap formation shon05034   Alcoholism shon05203   Viral carcinogenesis shon05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:shon00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     118986237  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     118986237   09163 Immune disease    05322 Systemic lupus erythematosus     118986237   09165 Substance dependence    05034 Alcoholism     118986237  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:shon03036]     118986237 Chromosome and associated proteins [BR:shon03036]  Eukaryotic type   Nucleosome assembly factors    Histones     118986237 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  118986237 NCBI-ProteinID:  XP_036900920 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaaaggcgggaagggcctcggcaaaggcggcgccaagcgccaccgc aaggttctgcgtgacaacatccagggcatcaccaagcccgccatccggcgcctggcccgc cgcggcggcgtcaagcgcatctccgggctcatctacgaggagacccgcggggtgctcaag gtcttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctttacggc ttcggcggctga

DBGET integrated database retrieval system