Sturnira hondurensis: 118987454 Help Entry 118987454         CDS       T07222                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism shon  Sturnira hondurensis Pathway shon04060   Cytokine-cytokine receptor interaction shon04620   Toll-like receptor signaling pathway shon04622   RIG-I-like receptor signaling pathway shon04625   C-type lectin receptor signaling pathway shon04630   JAK-STAT signaling pathway shon04658   Th1 and Th2 cell differentiation shon04936   Alcoholic liver disease shon04940   Type I diabetes mellitus shon05133   Pertussis shon05134   Legionellosis shon05140   Leishmaniasis shon05142   Chagas disease shon05143   African trypanosomiasis shon05144   Malaria shon05145   Toxoplasmosis shon05146   Amoebiasis shon05152   Tuberculosis shon05162   Measles shon05164   Influenza A shon05168   Herpes simplex virus 1 infection shon05171   Coronavirus disease - COVID-19 shon05200   Pathways in cancer shon05321   Inflammatory bowel disease shon05330   Allograft rejection shon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     118987454 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118987454 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     118987454 (IL12A)    04622 RIG-I-like receptor signaling pathway     118987454 (IL12A)    04625 C-type lectin receptor signaling pathway     118987454 (IL12A)    04658 Th1 and Th2 cell differentiation     118987454 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118987454 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     118987454 (IL12A)    05164 Influenza A     118987454 (IL12A)    05162 Measles     118987454 (IL12A)    05168 Herpes simplex virus 1 infection     118987454 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     118987454 (IL12A)    05134 Legionellosis     118987454 (IL12A)    05152 Tuberculosis     118987454 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     118987454 (IL12A)    05144 Malaria     118987454 (IL12A)    05145 Toxoplasmosis     118987454 (IL12A)    05140 Leishmaniasis     118987454 (IL12A)    05142 Chagas disease     118987454 (IL12A)    05143 African trypanosomiasis     118987454 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     118987454 (IL12A)    05330 Allograft rejection     118987454 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118987454 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     118987454 (IL12A)    04936 Alcoholic liver disease     118987454 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shon04052]     118987454 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:shon00536]     118987454 (IL12A) Cytokines and neuropeptides [BR:shon04052]  Cytokines   Interleukins    118987454 (IL12A) Glycosaminoglycan binding proteins [BR:shon00536]  Heparan sulfate / Heparin   Cytokines    118987454 (IL12A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12 RHH_1 Motif Other DBs NCBI-GeneID:  118987454 NCBI-ProteinID:  XP_036902539 LinkDB All DBs Position Unknown AA seq 232 aa AA seqDB search MEGRGRPNQVDNLSHPLPGLLLGAILVLLHHLSLARNLPTTLAGPEPTQCLSRAQNLLRA VSNTLHKAIQTLEFYSCTSEEVDHEDITKDKTSTVEACLPQELTTDESCLVSREISFTTN GTCLASKKASFMMTLCLSSIFEDLKIYQVEFKAISEKLLMDPQRQVTLDQNMLAAVDELM QALNSSSETAPPEPALGEPDLYKTKIRLCILLHAFRVRAVTIERVISYLNSS NT seq 699 nt NT seq  +upstreamnt  +downstreamnt atggaagggagaggcaggccaaatcaggtggacaacctcagccatccccttccaggcctc ctccttggggccatcctggtcctcctccaccacctcagtttggccaggaacctccccacc accctggcaggcccagaaccgacccagtgcctcagccgcgcccagaacctgctgagggcc gtcagcaacactcttcacaaggccatacaaactctagaattttactcctgcacttctgaa gaggtggatcatgaagacatcacaaaagataagacgagcacagtggaggcctgcttgccc caagaactaaccacggatgaaagttgcctggtctccagagagatctctttcacaactaat gggacctgcctggcttccaaaaaggcctcttttatgatgaccctgtgcctcagtagtatc tttgaggacttgaagatataccaagtggagttcaaggccatcagtgaaaagcttttgatg gatcctcagaggcaggtcaccctggatcaaaacatgctggcagctgttgatgagctgatg caggccctgaattccagcagcgagacagcgccacccgagcccgcccttggagaaccggac ctttacaagacgaaaatcaggctctgcatcctccttcatgctttcagagtccgggcagtg actatcgagagggtgataagctatctgaactcttcctaa

DBGET integrated database retrieval system