Sturnira hondurensis: 118987575 Help Entry 118987575         CDS       T07222                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism shon  Sturnira hondurensis Pathway shon03008   Ribosome biogenesis in eukaryotes shon03083   Polycomb repressive complex shon04064   NF-kappa B signaling pathway shon04137   Mitophagy - animal shon04310   Wnt signaling pathway shon04520   Adherens junction shon05010   Alzheimer disease shon05020   Prion disease shon05022   Pathways of neurodegeneration - multiple diseases shon05162   Measles shon05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:shon00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     118987575 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     118987575 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     118987575 (CSNK2B)    04064 NF-kappa B signaling pathway     118987575 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     118987575 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     118987575 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     118987575 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     118987575 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     118987575 (CSNK2B)    05020 Prion disease     118987575 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     118987575 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:shon03009]     118987575 (CSNK2B)    03036 Chromosome and associated proteins [BR:shon03036]     118987575 (CSNK2B) Ribosome biogenesis [BR:shon03009]  Eukaryotic type   90S particles    Kinase     118987575 (CSNK2B) Chromosome and associated proteins [BR:shon03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      118987575 (CSNK2B) SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  118987575 NCBI-ProteinID:  XP_036902658 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa ttcttctgtgaagtggatgaagattacatccaggacaaattcaacctcactggactcaat gagcaggtgcctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa gagctggaagacaacccgaaccagagtgacctgattgagcaggcagctgagatgctttat ggattgatccacgcccgctatatcctcaccaaccgtggcatcgcccagatgttggaaaaa taccagcagggagactttggctactgtccgcgtgtgtactgtgagaaccagccaatgctt cccatcggcctttcagacatcccaggtgaggccatggtgaagctctactgtcccaagtgc atggacgtgtacacacccaagtcatcaaggcaccaccacacggacggcgcctacttcggc actggtttccctcacatgctgttcatggtgcaccctgagtaccgacccaagcggcctgcc aaccagtttgtgcccaggctctacggtttcaagatccatccgatggcctaccagctgcag ctccaagccgcgagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system