Sturnira hondurensis: 118988104 Help Entry 118988104         CDS       T07222                                  Symbol MYL5 Name (RefSeq) myosin light chain 5   KO K12753   myosin regulatory light chain 5 Organism shon  Sturnira hondurensis Pathway shon04360   Axon guidance shon04510   Focal adhesion shon04520   Adherens junction shon04670   Leukocyte transendothelial migration shon04810   Regulation of actin cytoskeleton shon04814   Motor proteins shon04820   Cytoskeleton in muscle cells shon05132   Salmonella infection Brite KEGG Orthology (KO) [BR:shon00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     118988104 (MYL5)    04520 Adherens junction     118988104 (MYL5)   09142 Cell motility    04814 Motor proteins     118988104 (MYL5)    04820 Cytoskeleton in muscle cells     118988104 (MYL5)    04810 Regulation of actin cytoskeleton     118988104 (MYL5)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     118988104 (MYL5)   09158 Development and regeneration    04360 Axon guidance     118988104 (MYL5)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118988104 (MYL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:shon04812]     118988104 (MYL5) Cytoskeleton proteins [BR:shon04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      118988104 (MYL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 AIF-1 Caleosin SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  118988104 NCBI-ProteinID:  XP_036903395 LinkDB All DBs Position Unknown AA seq 173 aa AA seqDB search MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA SLGKINVKDDELDAMLKEASGPINFTMFLNMFGEKLSGTDTEETILNAFKMLDPESKGSV HKDYIKRLLMSQADKMTAEEVDQMFQFATIDAAGNLDYKALSYVLTHGEEKEE NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atggccagcaggaagaccaagaagaaggaggggggtgccctccgggcccaaagggcgtcc tccaatgtcttctccaacttcgagcagacccagatccaggagttcaaggaggccttcaca ctgatggatcagaaccgagatggcttcattgacaaggaggacctgaaagacacctacgcc tccctgggcaagatcaatgtcaaggatgacgagctggatgccatgctgaaggaggcctca gggcccatcaacttcaccatgttcctgaacatgttcggcgagaagctgagtggtacggac actgaggagaccatcctgaatgccttcaagatgctggaccccgaaagcaaaggcagcgtg cacaaggactacatcaaacggctgctcatgtcccaggcagacaagatgactgcagaggag gtcgaccagatgttccagtttgcgaccatcgacgctgcaggcaatctggactataaggcg ctgagctatgtgctcacccatggggaggagaaagaggagtga

DBGET integrated database retrieval system