Sturnira hondurensis: 118988151 Help Entry 118988151         CDS       T07222                                  Name (RefSeq) rab-like protein 2B   KO K07931   Rab-like protein 2 Organism shon  Sturnira hondurensis Brite KEGG Orthology (KO) [BR:shon00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:shon03037]     118988151    04031 GTP-binding proteins [BR:shon04031]     118988151 Cilium and associated proteins [BR:shon03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    118988151 GTP-binding proteins [BR:shon04031]  Small (monomeric) G-proteins   Rab Family    Rab-like     118988151 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Roc Ras Arf MMR_HSR1 G-alpha Gtr1_RagA AAA_7 MCM TniB Motif Other DBs NCBI-GeneID:  118988151 NCBI-ProteinID:  XP_036903461 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search MAGDTAKPFELDQEKYDAEDSVKIICLGDSAVGKSKLMERFLMDGFRPQQLSTYALTLYK HTATVDGRTVLVDFWDTAGQERFQSVQASYYHKAHACIMVRAQLGGGQRLRASLA NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggcgggggacacagccaaaccctttgagttggaccaggagaaatacgatgcggaggac agtgtgaaaatcatctgcctgggggacagcgctgtgggcaagtccaaactcatggagagg tttctcatggatggatttcggccccagcagctgtccacctatgccctgaccctctacaag cacacggccacggtggacggcaggacggtgcttgtggacttttgggacacagcaggccag gagcggttccagagtgtgcaggcctcctactaccacaaggcccacgcctgcatcatggta cgagcccagctgggaggcgggcagaggctcagggcaagtctggcctga

DBGET integrated database retrieval system