Sturnira hondurensis: 118988447 Help Entry 118988447         CDS       T07222                                  Symbol RAB1A Name (RefSeq) ras-related protein Rab-1A   KO K07874   Ras-related protein Rab-1A Organism shon  Sturnira hondurensis Pathway shon04140   Autophagy - animal shon05014   Amyotrophic lateral sclerosis shon05022   Pathways of neurodegeneration - multiple diseases shon05134   Legionellosis Brite KEGG Orthology (KO) [BR:shon00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118988447 (RAB1A)  09160 Human Diseases   09171 Infectious disease: bacterial    05134 Legionellosis     118988447 (RAB1A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     118988447 (RAB1A)    05022 Pathways of neurodegeneration - multiple diseases     118988447 (RAB1A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shon04131]     118988447 (RAB1A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shon04147]     118988447 (RAB1A)    04031 GTP-binding proteins [BR:shon04031]     118988447 (RAB1A) Membrane trafficking [BR:shon04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab GTPases     118988447 (RAB1A)  Autophagy   Other autophagy associated proteins     118988447 (RAB1A) Exosome [BR:shon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118988447 (RAB1A)   Exosomal proteins of other body fluids (saliva and urine)    118988447 (RAB1A)   Exosomal proteins of colorectal cancer cells    118988447 (RAB1A) GTP-binding proteins [BR:shon04031]  Small (monomeric) G-proteins   Rab Family    Rab1/35 [OT]     118988447 (RAB1A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 Gtr1_RagA SRPRB FeoB_N AAA ABC_tran AAA_7 PduV-EutP AAA_16 LANC_like AAA_29 Septin AAA_22 AAA_5 CRAL_TRIO_2 Motif Other DBs NCBI-GeneID:  118988447 NCBI-ProteinID:  XP_036903949 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGA TAGGAEKSNVKIQSTPVKQSGGGCC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtccagcatgaatcccgaatatgattatttattcaagttgcttctgattggagactct ggagttggaaagtcttgcctcctccttaggtttgcagatgatacgtatacagaaagctac attagcactattggtgtggatttcaaaataagaactatagagttagatgggaaaacaatc aagcttcaaatatgggacacagcaggccaagaaagattccgaacaatcacctccagttat tacagaggagcccatggcatcatagttgtgtatgatgtgacagatcaggagtccttcaat aacgttaaacagtggctgcaggaaattgatcgttacgccagtgaaaacgtcaacaagttg ttggtagggaacaaatgtgatctgaccacaaagaaagtagtagactacacaacagcaaag gaatttgctgattcccttggaattccgtttttggaaaccagtgctaagaatgcaacaaat gtagaacagtctttcatgacaatggcagctgagattaagaaacgaatgggtcctggagca acagctggtggtgcagagaagtccaatgttaaaattcaaagcactccagtcaagcagtca ggtggaggttgctgctaa

DBGET integrated database retrieval system