Sturnira hondurensis: 118992368 Help Entry 118992368         CDS       T07222                                  Symbol ARF6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism shon  Sturnira hondurensis Pathway shon04014   Ras signaling pathway shon04072   Phospholipase D signaling pathway shon04144   Endocytosis shon04666   Fc gamma R-mediated phagocytosis shon05132   Salmonella infection shon05135   Yersinia infection Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     118992368 (ARF6)    04072 Phospholipase D signaling pathway     118992368 (ARF6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118992368 (ARF6)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     118992368 (ARF6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118992368 (ARF6)    05135 Yersinia infection     118992368 (ARF6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shon04131]     118992368 (ARF6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shon04147]     118992368 (ARF6)    04031 GTP-binding proteins [BR:shon04031]     118992368 (ARF6) Membrane trafficking [BR:shon04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     118992368 (ARF6)   Arf GTPases and associated proteins    Arf GTPases     118992368 (ARF6) Exosome [BR:shon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118992368 (ARF6)   Exosomal proteins of colorectal cancer cells    118992368 (ARF6) GTP-binding proteins [BR:shon04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     118992368 (ARF6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  118992368 NCBI-ProteinID:  XP_036910145 LinkDB All DBs Position Unknown AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaggtgctatccaagatcttcgggaacaaggaaatgcggatcctcatgttgggc ctggacgcggccggcaagaccacgatcctgtacaagttgaagctgggccagtcggtgacc accatccccaccgtgggtttcaacgtggagacggtgacttacaaaaatgtcaagttcaac gtgtgggatgtgggcggccaggacaagatccggccgctctggcggcattactacaccggg acccagggtctgatcttcgttgtggactgcgccgaccgcgaccgcatcgacgaggcccgc caggagctgcaccgcattatcaatgaccgggagatgagggacgccataatcctcatcttc gccaacaagcaggacctgcccgatgccatgaaaccccacgagatccaggagaaactgggc ctgacccggattcgggacaggaactggtatgtgcagccctcctgtgccacctcgggggac ggactctatgaggggctcacatggttaacctctaactacaaatcctaa

DBGET integrated database retrieval system