Sturnira hondurensis: 118993330 Help Entry 118993330         CDS       T07222                                  Symbol GHRL Name (RefSeq) appetite-regulating hormone   KO K05254   ghrelin Organism shon  Sturnira hondurensis Pathway shon04024   cAMP signaling pathway shon04080   Neuroactive ligand-receptor interaction shon04081   Hormone signaling shon04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     118993330 (GHRL)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     118993330 (GHRL)    04081 Hormone signaling     118993330 (GHRL)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     118993330 (GHRL)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shon04052]     118993330 (GHRL) Cytokines and neuropeptides [BR:shon04052]  Neuropeptides   GPCR binding    118993330 (GHRL) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Motilin_assoc Motilin_ghrelin Motif Other DBs NCBI-GeneID:  118993330 NCBI-ProteinID:  XP_036911494 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MPSLRTICSLLLLSVLCMDLAMAGSSFLSPEHQKVPRKESKKPRAKLQPRELQGWLRPED GNQAEGAEDELEIRFDAPFDVEIKLSGAQDHQHGQALGKFLQDMFWEEANEAPADK NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgccctccctgagaaccatctgcagcctgctgctcctcagtgtgctctgcatggacctg gccatggctggctccagcttcctgagccctgaacaccagaaagtgccgagaaaggagtcc aagaagcctcgagccaaactgcagccccgtgagctccagggctggctccgcccagaagat ggaaatcaggcagaaggggcagaggatgagctggaaattcggttcgatgccccctttgat gttgaaatcaagctgtcaggggctcaggaccatcagcatggccaggccctggggaagttt cttcaggacatgttttgggaagaggccaatgaggccccagcagacaagtga

DBGET integrated database retrieval system