Sturnira hondurensis: 118993715 Help Entry 118993715         CDS       T07222                                  Name (RefSeq) ubiquitin-like   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism shon  Sturnira hondurensis Pathway shon03010   Ribosome shon04120   Ubiquitin mediated proteolysis shon04137   Mitophagy - animal shon04140   Autophagy - animal shon05012   Parkinson disease shon05022   Pathways of neurodegeneration - multiple diseases shon05167   Kaposi sarcoma-associated herpesvirus infection shon05171   Coronavirus disease Brite KEGG Orthology (KO) [BR:shon00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     118993715   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     118993715  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118993715    04137 Mitophagy - animal     118993715  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease     118993715    05167 Kaposi sarcoma-associated herpesvirus infection     118993715   09164 Neurodegenerative disease    05012 Parkinson disease     118993715    05022 Pathways of neurodegeneration - multiple diseases     118993715  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:shon03011]     118993715    04121 Ubiquitin system [BR:shon04121]     118993715   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shon04147]     118993715 Ribosome [BR:shon03011]  Ribosomal proteins   Eukaryotes    Small subunit     118993715   Archaea     118993715 Ubiquitin system [BR:shon04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    118993715 Exosome [BR:shon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118993715   Exosomal proteins of colorectal cancer cells    118993715 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ribosomal_S27 Rad60-SLD Motif Other DBs NCBI-GeneID:  118993715 NCBI-ProteinID:  XP_036912114 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MQIFMETLAGKTLSLKAEPSGTIENVAAKVQGKEGVPPDWQRLTFAAKHLEVGCTLSDCS IGKVSPPHLVLRLQGGAKKRQKSYGTAKNMHNRTKVRLDVLKYYEVDEKDKITCLHWEHH SGECDAGGVMASHLER NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgcagattttcatggaaacccttgcaggaaagaccctcagtctcaaggctgagccctca ggtacaatagaaaatgtagcggccaaggtccagggtaaggaaggagttcctcctgattgg caaagactgacctttgctgccaagcacctggaagttggatgtactttgtctgactgcagc attggaaaggtatcccctcctcatcttgtgttgagactccaaggaggtgctaagaaaagg cagaagtcttatggcacggccaagaatatgcataacagaacgaaggttaggttggatgtc ctgaaatactatgaggtggatgagaaggacaaaatcacttgccttcattgggagcaccat tcaggtgaatgtgacgctggaggtgtcatggccagccacttggaaagatag

DBGET integrated database retrieval system