Sturnira hondurensis: 118993928 Help Entry 118993928         CDS       T07222                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism shon  Sturnira hondurensis Pathway shon04024   cAMP signaling pathway shon04062   Chemokine signaling pathway shon04064   NF-kappa B signaling pathway shon04210   Apoptosis shon04380   Osteoclast differentiation shon04620   Toll-like receptor signaling pathway shon04621   NOD-like receptor signaling pathway shon04622   RIG-I-like receptor signaling pathway shon04623   Cytosolic DNA-sensing pathway shon04625   C-type lectin receptor signaling pathway shon04657   IL-17 signaling pathway shon04658   Th1 and Th2 cell differentiation shon04659   Th17 cell differentiation shon04660   T cell receptor signaling pathway shon04662   B cell receptor signaling pathway shon04668   TNF signaling pathway shon04722   Neurotrophin signaling pathway shon04920   Adipocytokine signaling pathway shon04926   Relaxin signaling pathway shon04931   Insulin resistance shon04936   Alcoholic liver disease shon05132   Salmonella infection shon05134   Legionellosis shon05135   Yersinia infection shon05140   Leishmaniasis shon05142   Chagas disease shon05145   Toxoplasmosis shon05160   Hepatitis C shon05161   Hepatitis B shon05162   Measles shon05163   Human cytomegalovirus infection shon05164   Influenza A shon05166   Human T-cell leukemia virus 1 infection shon05167   Kaposi sarcoma-associated herpesvirus infection shon05168   Herpes simplex virus 1 infection shon05169   Epstein-Barr virus infection shon05170   Human immunodeficiency virus 1 infection shon05171   Coronavirus disease - COVID-19 shon05200   Pathways in cancer shon05203   Viral carcinogenesis shon05208   Chemical carcinogenesis - reactive oxygen species shon05215   Prostate cancer shon05220   Chronic myeloid leukemia shon05222   Small cell lung cancer shon05235   PD-L1 expression and PD-1 checkpoint pathway in cancer shon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     118993928 (NFKBIA)    04668 TNF signaling pathway     118993928 (NFKBIA)    04024 cAMP signaling pathway     118993928 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     118993928 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     118993928 (NFKBIA)    04621 NOD-like receptor signaling pathway     118993928 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     118993928 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     118993928 (NFKBIA)    04625 C-type lectin receptor signaling pathway     118993928 (NFKBIA)    04660 T cell receptor signaling pathway     118993928 (NFKBIA)    04658 Th1 and Th2 cell differentiation     118993928 (NFKBIA)    04659 Th17 cell differentiation     118993928 (NFKBIA)    04657 IL-17 signaling pathway     118993928 (NFKBIA)    04662 B cell receptor signaling pathway     118993928 (NFKBIA)    04062 Chemokine signaling pathway     118993928 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     118993928 (NFKBIA)    04926 Relaxin signaling pathway     118993928 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     118993928 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     118993928 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118993928 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     118993928 (NFKBIA)    05203 Viral carcinogenesis     118993928 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     118993928 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     118993928 (NFKBIA)    05215 Prostate cancer     118993928 (NFKBIA)    05222 Small cell lung cancer     118993928 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     118993928 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     118993928 (NFKBIA)    05161 Hepatitis B     118993928 (NFKBIA)    05160 Hepatitis C     118993928 (NFKBIA)    05171 Coronavirus disease - COVID-19     118993928 (NFKBIA)    05164 Influenza A     118993928 (NFKBIA)    05162 Measles     118993928 (NFKBIA)    05168 Herpes simplex virus 1 infection     118993928 (NFKBIA)    05163 Human cytomegalovirus infection     118993928 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     118993928 (NFKBIA)    05169 Epstein-Barr virus infection     118993928 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     118993928 (NFKBIA)    05135 Yersinia infection     118993928 (NFKBIA)    05134 Legionellosis     118993928 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     118993928 (NFKBIA)    05140 Leishmaniasis     118993928 (NFKBIA)    05142 Chagas disease     118993928 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118993928 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     118993928 (NFKBIA)    04931 Insulin resistance     118993928 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:shon03000]     118993928 (NFKBIA)    04131 Membrane trafficking [BR:shon04131]     118993928 (NFKBIA) Transcription factors [BR:shon03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     118993928 (NFKBIA) Membrane trafficking [BR:shon04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     118993928 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  118993928 NCBI-ProteinID:  XP_036912351 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFHPAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEDYEQMVKELREINLQPPEVL CSPEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCGTQHLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVIGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcaccctgccgagcacgcccaggactgggccatggagggcccccgggacgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gactacgagcagatggtgaaggagctgcgagagatcaacctccagccgccggaggtgctg tgtagcccagagccctggaagcagcagctcaccgaggacggagactcgttcttgcacttg gccatcatccatgaagagaaggcactgacaatggaagtggtccgccaagtgaagggagac ctggcgtttcttaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccagccagaaattgctgaggcacttctgggagctggctgtgatcctgagctccgt gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg ggagtcctgactcagagctgtgggacccagcacctccactccatcctgcaggccaccaac tacaatggccacacgtgtctgcacttagcctctatccatggctacctgggcatcgtggag cttctggtgtccttgggtgctgatgtcaatgctcaggagccctgtaatggtcgaactgcc cttcatcttgcggtggacctgcagaatcctgacctggtgtctctcctgctgaagtgcggg gctgacgtcaacagagtcacctaccagggctactccccataccagcttacctggggccgc ccaagcacccggatacagcagcaactgggccagctgaccctagaaaaccttcagatgctg ccagagagtgaggatgaggagagctatgatacggagtccgagttcacagaggatgagctg ccctatgatgactgcgttatcggaggccagcgcctgacgttatga

DBGET integrated database retrieval system