Sturnira hondurensis: 118993942 Help Entry 118993942         CDS       T07222                                  Symbol CFL2 Name (RefSeq) cofilin-2 isoform X1   KO K05765   cofilin Organism shon  Sturnira hondurensis Pathway shon04360   Axon guidance shon04666   Fc gamma R-mediated phagocytosis shon04810   Regulation of actin cytoskeleton shon05133   Pertussis shon05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:shon00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     118993942 (CFL2)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     118993942 (CFL2)   09158 Development and regeneration    04360 Axon guidance     118993942 (CFL2)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     118993942 (CFL2)   09171 Infectious disease: bacterial    05133 Pertussis     118993942 (CFL2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shon04131]     118993942 (CFL2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:shon04812]     118993942 (CFL2)    04147 Exosome [BR:shon04147]     118993942 (CFL2) Membrane trafficking [BR:shon04131]  Others   Actin-binding proteins    Others     118993942 (CFL2) Cytoskeleton proteins [BR:shon04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      118993942 (CFL2) Exosome [BR:shon04147]  Exosomal proteins   Proteins found in most exosomes    118993942 (CFL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  118993942 NCBI-ProteinID:  XP_036912366 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDI GDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcttctggagttacagtgaatgatgaagtcatcaaagtttttaatgatatgaaagta aggaaatcttctacacaagaggagatcaaaaaaagaaagaaagcagtcctcttctgttta agcgatgacaaaagacaaataattgtagaagaagcaaagcagatcttggtgggtgacatt ggtgatactgtagaggacccctacacatcttttgtgaagttgctacctctgaatgattgc cgatatgctttgtacgatgccacatacgaaacaaaagagtctaagaaagaagacctagta tttatattctgggcccctgaaagtgcacctttaaaaagcaagatgatctatgccagctct aaagatgccattaaaaagaaatttacaggtattaaacatgagtggcaagtaaatggcttg gatgacataaaggaccgttcgacacttggagagaaattgggaggcaacgtagtagtttca cttgaaggaaaacccttataa

DBGET integrated database retrieval system