Sturnira hondurensis: 118994089 Help Entry 118994089         CDS       T07222                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism shon  Sturnira hondurensis Pathway shon04382   Cornified envelope formation shon05132   Salmonella infection Brite KEGG Orthology (KO) [BR:shon00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     118994089  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118994089  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shon04147]     118994089 Exosome [BR:shon04147]  Exosomal proteins   Exosomal proteins of microglial cells    118994089 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EFhand_Ca_insen EF-hand_7 DUF1484 EF-hand_1 Motif Other DBs NCBI-GeneID:  118994089 NCBI-ProteinID:  XP_036912542 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETMIFTFHRFTGDKVYLTKEDLRILMEKEFHGFLENKKDPLAIDKIMEDLD QCRHGQVGFQSFFSLIAGLTMACNHCFVVHMKQKRKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacacgccatggaaaccatgatattcacatttcacagattcact ggggataaagtctacttaacaaaggaggacctgagaatactaatggaaaaggagttccat ggatttttggagaataaaaaagaccctttggccatagacaaaataatggaagacctggac cagtgccgacatggccaagtgggcttccagagcttcttttcgctaattgctggcctcacc atggcatgcaatcactgttttgtagtacacatgaagcagaagcgaaagaagtag

DBGET integrated database retrieval system