Sturnira hondurensis: 118994775
Help
Entry
118994775 CDS
T07222
Symbol
FXYD6
Name
(RefSeq) FXYD domain-containing ion transport regulator 6 isoform X1
KO
K13363
FXYD domain-containing ion transport regulator 6
Organism
shon
Sturnira hondurensis
Brite
KEGG Orthology (KO) [BR:
shon00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
shon02000
]
118994775 (FXYD6)
Transporters [BR:
shon02000
]
Other transporters
Pores ion channels [TC:
1
]
118994775 (FXYD6)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
ATP1G1_PLM_MAT8
Glycophorin_A
DUF6095
Motif
Other DBs
NCBI-GeneID:
118994775
NCBI-ProteinID:
XP_036913396
LinkDB
All DBs
Position
Unknown
AA seq
94 aa
AA seq
DB search
MEVVLIFLCSLLAPTVLASAEQEKETDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRC
KCSFSQKPRAPGDEEAQVENLITANATEPQKAEN
NT seq
285 nt
NT seq
+upstream
nt +downstream
nt
atggaggtggtgctgatctttctgtgcagcctgctggcccccactgtcctggccagtgct
gagcaggagaaagaaacggacccttttcattacgattatcagacactgaggatcggggga
ttggtgtttgctgtggtcctcttctctgtcggaatcctcctcatcctgagtcgaagatgc
aagtgcagcttcagtcagaagcctcgggctccaggggatgaggaggcccaggtggagaac
ctcatcactgcaaatgcaacagagccccagaaagcagagaactga
DBGET
integrated database retrieval system