Sturnira hondurensis: 118997925 Help Entry 118997925         CDS       T07222                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism shon  Sturnira hondurensis Pathway shon04015   Rap1 signaling pathway shon04810   Regulation of actin cytoskeleton shon05014   Amyotrophic lateral sclerosis shon05132   Salmonella infection Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     118997925 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     118997925 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118997925 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     118997925 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shon04131]     118997925 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:shon04812]     118997925 (PFN2)    04147 Exosome [BR:shon04147]     118997925 (PFN2) Membrane trafficking [BR:shon04131]  Others   Actin-binding proteins    Others     118997925 (PFN2) Cytoskeleton proteins [BR:shon04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      118997925 (PFN2) Exosome [BR:shon04147]  Exosomal proteins   Proteins found in most exosomes    118997925 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  118997925 NCBI-ProteinID:  XP_036917726 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAASAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagcctcggctgggggcgttttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggagcaaagaagtgctcagtgatcagagatagtctatacgtt gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgcagtgggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system