Sturnira hondurensis: 118999087 Help Entry 118999087         CDS       T07222                                  Symbol CXCL6 Name (RefSeq) C-X-C motif chemokine 6   KO K05506   C-X-C motif chemokine 5/6 Organism shon  Sturnira hondurensis Pathway shon04060   Cytokine-cytokine receptor interaction shon04061   Viral protein interaction with cytokine and cytokine receptor shon04062   Chemokine signaling pathway shon04657   IL-17 signaling pathway shon04668   TNF signaling pathway shon05133   Pertussis shon05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     118999087 (CXCL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118999087 (CXCL6)    04061 Viral protein interaction with cytokine and cytokine receptor     118999087 (CXCL6)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     118999087 (CXCL6)    04062 Chemokine signaling pathway     118999087 (CXCL6)  09160 Human Diseases   09171 Infectious disease: bacterial    05133 Pertussis     118999087 (CXCL6)   09163 Immune disease    05323 Rheumatoid arthritis     118999087 (CXCL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shon04052]     118999087 (CXCL6) Cytokines and neuropeptides [BR:shon04052]  Cytokines   Chemokines    118999087 (CXCL6) SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  118999087 NCBI-ProteinID:  XP_036919321 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MSLLRSSATRFPGPSGSLCALLALLLLLLLTPPRPLASAGPSSSSVRELRCQCLTITPTV HPKMISNLEMIVAGPQCPKVELIATLKNGKEVCLDPEAPLVKKIIQKILRSRPQKN NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgagtctcctgcgcagctccgctacccgcttccccggcccttcaggatctctttgcgcg ctgcttgcgctgctgctgctgctgctgctgacgccgcccaggcccctggccagcgctggt ccttcctcgtcctcagtgagagagctgcgttgccagtgtttaaccatcacacccacggtg catccaaaaatgatcagtaatctggagatgatcgttgcaggcccgcagtgccccaaggtg gaactcatagccaccttgaagaacgggaaggaagtctgtctggacccagaagcccctttg gtcaagaaaatcatccagaaaattctgaggagtagaccgcagaaaaattaa

DBGET integrated database retrieval system