Sturnira hondurensis: 119000796 Help Entry 119000796         CDS       T07222                                  Name (RefSeq) calmodulin-A-like   KO K02183   calmodulin Organism shon  Sturnira hondurensis Pathway shon04014   Ras signaling pathway shon04015   Rap1 signaling pathway shon04020   Calcium signaling pathway shon04022   cGMP-PKG signaling pathway shon04024   cAMP signaling pathway shon04070   Phosphatidylinositol signaling system shon04114   Oocyte meiosis shon04218   Cellular senescence shon04261   Adrenergic signaling in cardiomyocytes shon04270   Vascular smooth muscle contraction shon04371   Apelin signaling pathway shon04625   C-type lectin receptor signaling pathway shon04713   Circadian entrainment shon04720   Long-term potentiation shon04722   Neurotrophin signaling pathway shon04728   Dopaminergic synapse shon04740   Olfactory transduction shon04744   Phototransduction shon04750   Inflammatory mediator regulation of TRP channels shon04910   Insulin signaling pathway shon04912   GnRH signaling pathway shon04915   Estrogen signaling pathway shon04916   Melanogenesis shon04921   Oxytocin signaling pathway shon04922   Glucagon signaling pathway shon04924   Renin secretion shon04925   Aldosterone synthesis and secretion shon04970   Salivary secretion shon04971   Gastric acid secretion shon05010   Alzheimer disease shon05012   Parkinson disease shon05022   Pathways of neurodegeneration - multiple diseases shon05031   Amphetamine addiction shon05034   Alcoholism shon05133   Pertussis shon05152   Tuberculosis shon05163   Human cytomegalovirus infection shon05167   Kaposi sarcoma-associated herpesvirus infection shon05170   Human immunodeficiency virus 1 infection shon05200   Pathways in cancer shon05214   Glioma shon05417   Lipid and atherosclerosis shon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     119000796    04015 Rap1 signaling pathway     119000796    04371 Apelin signaling pathway     119000796    04020 Calcium signaling pathway     119000796    04070 Phosphatidylinositol signaling system     119000796    04024 cAMP signaling pathway     119000796    04022 cGMP-PKG signaling pathway     119000796  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     119000796    04218 Cellular senescence     119000796  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     119000796   09152 Endocrine system    04910 Insulin signaling pathway     119000796    04922 Glucagon signaling pathway     119000796    04912 GnRH signaling pathway     119000796    04915 Estrogen signaling pathway     119000796    04921 Oxytocin signaling pathway     119000796    04916 Melanogenesis     119000796    04924 Renin secretion     119000796    04925 Aldosterone synthesis and secretion     119000796   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     119000796    04270 Vascular smooth muscle contraction     119000796   09154 Digestive system    04970 Salivary secretion     119000796    04971 Gastric acid secretion     119000796   09156 Nervous system    04728 Dopaminergic synapse     119000796    04720 Long-term potentiation     119000796    04722 Neurotrophin signaling pathway     119000796   09157 Sensory system    04744 Phototransduction     119000796    04740 Olfactory transduction     119000796    04750 Inflammatory mediator regulation of TRP channels     119000796   09159 Environmental adaptation    04713 Circadian entrainment     119000796  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119000796   09162 Cancer: specific types    05214 Glioma     119000796   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     119000796    05163 Human cytomegalovirus infection     119000796    05167 Kaposi sarcoma-associated herpesvirus infection     119000796   09171 Infectious disease: bacterial    05133 Pertussis     119000796    05152 Tuberculosis     119000796   09164 Neurodegenerative disease    05010 Alzheimer disease     119000796    05012 Parkinson disease     119000796    05022 Pathways of neurodegeneration - multiple diseases     119000796   09165 Substance dependence    05031 Amphetamine addiction     119000796    05034 Alcoholism     119000796   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119000796    05418 Fluid shear stress and atherosclerosis     119000796  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:shon01009]     119000796   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shon04131]     119000796    03036 Chromosome and associated proteins [BR:shon03036]     119000796   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shon04147]     119000796 Protein phosphatases and associated proteins [BR:shon01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      119000796 Membrane trafficking [BR:shon04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     119000796 Chromosome and associated proteins [BR:shon03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      119000796 Exosome [BR:shon04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    119000796 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EF-hand_FSTL1 EF_EFCAB10_C EH SPARC_Ca_bdg Dockerin_1 Temptin_C SAPC2_N EF-hand_EFHB_C EF-hand_STIM1 EF-hand_11 DUF5580_M ThsA_Macro SCO1-SenC RNB Motif Other DBs NCBI-GeneID:  119000796 NCBI-ProteinID:  XP_036921791 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MAEDLSKEQVAEFKAAFTRFDKNGDGTINVQELGDVLKTLGQNPSEDELKNIIAHVDTDG DGAISFPEFLAAMAKRMKSWGGEQDMKEVFQAFDLDGDGHITIDELKQAMVRLGQKLTQE DLEAMIQEADLDKDGQVNYEEFSRILSQK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagaggatctgtctaaagagcaggtggctgagttcaaggcggccttcaccaggttt gacaagaacggggatggcaccatcaacgtgcaggagctgggagatgtcctgaagaccctg ggccagaacccatcagaggacgagctgaagaatatcattgcccacgtagacacggatggt gatggcgccatcagcttcccggagttcctggcagcgatggctaagaggatgaagtcctgg ggtggtgagcaggacatgaaggaggtgttccaagccttcgacctggacggggacggccat atcaccattgatgagctcaaacaggccatggtccggttggggcagaagctcacccaggaa gatctggaggccatgatccaggaggcagacctggacaaggatggacaggtgaactatgaa gagttctcgcgcatcctcagccagaagtga

DBGET integrated database retrieval system