Sturnira hondurensis: 119001010 Help Entry 119001010         CDS       T07222                                  Name (RefSeq) calmodulin-2/4   KO K02183   calmodulin Organism shon  Sturnira hondurensis Pathway shon04014   Ras signaling pathway shon04015   Rap1 signaling pathway shon04020   Calcium signaling pathway shon04022   cGMP-PKG signaling pathway shon04024   cAMP signaling pathway shon04070   Phosphatidylinositol signaling system shon04114   Oocyte meiosis shon04218   Cellular senescence shon04261   Adrenergic signaling in cardiomyocytes shon04270   Vascular smooth muscle contraction shon04371   Apelin signaling pathway shon04625   C-type lectin receptor signaling pathway shon04713   Circadian entrainment shon04720   Long-term potentiation shon04722   Neurotrophin signaling pathway shon04728   Dopaminergic synapse shon04740   Olfactory transduction shon04744   Phototransduction shon04750   Inflammatory mediator regulation of TRP channels shon04910   Insulin signaling pathway shon04912   GnRH signaling pathway shon04915   Estrogen signaling pathway shon04916   Melanogenesis shon04921   Oxytocin signaling pathway shon04922   Glucagon signaling pathway shon04924   Renin secretion shon04925   Aldosterone synthesis and secretion shon04970   Salivary secretion shon04971   Gastric acid secretion shon05010   Alzheimer disease shon05012   Parkinson disease shon05022   Pathways of neurodegeneration - multiple diseases shon05031   Amphetamine addiction shon05034   Alcoholism shon05133   Pertussis shon05152   Tuberculosis shon05163   Human cytomegalovirus infection shon05167   Kaposi sarcoma-associated herpesvirus infection shon05170   Human immunodeficiency virus 1 infection shon05200   Pathways in cancer shon05214   Glioma shon05417   Lipid and atherosclerosis shon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     119001010    04015 Rap1 signaling pathway     119001010    04371 Apelin signaling pathway     119001010    04020 Calcium signaling pathway     119001010    04070 Phosphatidylinositol signaling system     119001010    04024 cAMP signaling pathway     119001010    04022 cGMP-PKG signaling pathway     119001010  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     119001010    04218 Cellular senescence     119001010  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     119001010   09152 Endocrine system    04910 Insulin signaling pathway     119001010    04922 Glucagon signaling pathway     119001010    04912 GnRH signaling pathway     119001010    04915 Estrogen signaling pathway     119001010    04921 Oxytocin signaling pathway     119001010    04916 Melanogenesis     119001010    04924 Renin secretion     119001010    04925 Aldosterone synthesis and secretion     119001010   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     119001010    04270 Vascular smooth muscle contraction     119001010   09154 Digestive system    04970 Salivary secretion     119001010    04971 Gastric acid secretion     119001010   09156 Nervous system    04728 Dopaminergic synapse     119001010    04720 Long-term potentiation     119001010    04722 Neurotrophin signaling pathway     119001010   09157 Sensory system    04744 Phototransduction     119001010    04740 Olfactory transduction     119001010    04750 Inflammatory mediator regulation of TRP channels     119001010   09159 Environmental adaptation    04713 Circadian entrainment     119001010  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119001010   09162 Cancer: specific types    05214 Glioma     119001010   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     119001010    05163 Human cytomegalovirus infection     119001010    05167 Kaposi sarcoma-associated herpesvirus infection     119001010   09171 Infectious disease: bacterial    05133 Pertussis     119001010    05152 Tuberculosis     119001010   09164 Neurodegenerative disease    05010 Alzheimer disease     119001010    05012 Parkinson disease     119001010    05022 Pathways of neurodegeneration - multiple diseases     119001010   09165 Substance dependence    05031 Amphetamine addiction     119001010    05034 Alcoholism     119001010   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119001010    05418 Fluid shear stress and atherosclerosis     119001010  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:shon01009]     119001010   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shon04131]     119001010    03036 Chromosome and associated proteins [BR:shon03036]     119001010   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shon04147]     119001010 Protein phosphatases and associated proteins [BR:shon01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      119001010 Membrane trafficking [BR:shon04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     119001010 Chromosome and associated proteins [BR:shon03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      119001010 Exosome [BR:shon04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    119001010 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EF-hand_4 EF-hand_11 EFhand_Ca_insen SPARC_Ca_bdg UPF0154 DUF5580_M Dockerin_1 Poly_export PA_Ig-like MotA_activ SurA_N_2 RNA_pol_Rpb4 DUF6279 SurA_N_3 Motif Other DBs NCBI-GeneID:  119001010 NCBI-ProteinID:  XP_036922067 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD QNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgagatcgctaggacagaacccaactgaggcggaactccaggacatgattaacgaggtt gatgctgatggaaatggtaccattgattttcctgagttcctgaacctcatggcaaggaag atgaaggataccgattccgaggaggagctcaaggaggcattcagagtttttgacaaggat cagaacggtttcatctccgcagctgagctccgtcatgtgatgactaatcttggtgagaag cttaccgatgaagaggtcgatgagatgatcagagaagctgatgtggatggtgatggccag ataaattatgaggaatttgtcaaggttatgatggccaagtga

DBGET integrated database retrieval system