Sturnira hondurensis: 119001070 Help Entry 119001070         CDS       T07222                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism shon  Sturnira hondurensis Pathway shon04015   Rap1 signaling pathway shon04810   Regulation of actin cytoskeleton shon05014   Amyotrophic lateral sclerosis shon05132   Salmonella infection Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     119001070 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     119001070 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119001070 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     119001070 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shon04131]     119001070 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:shon04812]     119001070 (PFN1)    04147 Exosome [BR:shon04147]     119001070 (PFN1) Membrane trafficking [BR:shon04131]  Others   Actin-binding proteins    Others     119001070 (PFN1) Cytoskeleton proteins [BR:shon04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      119001070 (PFN1) Exosome [BR:shon04147]  Exosomal proteins   Proteins found in most exosomes    119001070 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  119001070 NCBI-ProteinID:  XP_036922140 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVAVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccgggaaaaccttc gtcaacatcacgccagccgaggttgctgtcctagttggcaaagaccggtcaagttttttc gtgaatgggctgacacttgggggccagaaatgttctgtgatccgggactcactgctgcag gatggggaatttaccatggatcttcgtaccaagagcaccgggggagctcctaccttcaac attactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtatgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system