Sturnira hondurensis: 119001525 Help Entry 119001525         CDS       T07222                                  Name (RefSeq) C-C motif chemokine 15-like   KO K05511   C-C motif chemokine 15/23 Organism shon  Sturnira hondurensis Pathway shon04060   Cytokine-cytokine receptor interaction shon04061   Viral protein interaction with cytokine and cytokine receptor shon04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119001525    04061 Viral protein interaction with cytokine and cytokine receptor     119001525  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     119001525  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shon04052]     119001525 Cytokines and neuropeptides [BR:shon04052]  Cytokines   Chemokines    119001525 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  119001525 NCBI-ProteinID:  XP_036922826 LinkDB All DBs Position Unknown AA seq 121 aa AA seqDB search MKVFAAALPFLILAAALGPQTHGLAPDELGLAIREPHRPMIQHAGVHRPTDCCSSFTPRS IRCKIMESYYETSSGCSQPAVIFITKRGQQVCADPHSRRVQHCLEKLNSELGKRLGEEEL Y NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgaaggtcttcgcagctgccctccccttcctcatccttgctgccgcccttggaccccag acccatggactggcacctgatgaactcgggttggccatacgtgagccgcatcgtcccatg atacagcatgcaggcgtgcaccgtcccactgactgctgctcttccttcaccccacgaagt atccgatgtaaaatcatggagagttattatgaaacgagcagtgggtgctcccagcctgct gtcatcttcatcaccaagagggggcagcaggtctgtgcagacccccacagtaggagagtt cagcattgtttggagaagctgaactcagaacttggaaaacggttgggtgaggaggagctg tactag

DBGET integrated database retrieval system