KEGG   Sturnira hondurensis: 119001903
Entry
119001903         CDS       T07222                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
shon  Sturnira hondurensis
Pathway
shon01521  EGFR tyrosine kinase inhibitor resistance
shon01522  Endocrine resistance
shon01524  Platinum drug resistance
shon04010  MAPK signaling pathway
shon04012  ErbB signaling pathway
shon04014  Ras signaling pathway
shon04015  Rap1 signaling pathway
shon04022  cGMP-PKG signaling pathway
shon04024  cAMP signaling pathway
shon04062  Chemokine signaling pathway
shon04066  HIF-1 signaling pathway
shon04068  FoxO signaling pathway
shon04071  Sphingolipid signaling pathway
shon04072  Phospholipase D signaling pathway
shon04114  Oocyte meiosis
shon04140  Autophagy - animal
shon04148  Efferocytosis
shon04150  mTOR signaling pathway
shon04151  PI3K-Akt signaling pathway
shon04210  Apoptosis
shon04218  Cellular senescence
shon04261  Adrenergic signaling in cardiomyocytes
shon04270  Vascular smooth muscle contraction
shon04350  TGF-beta signaling pathway
shon04360  Axon guidance
shon04370  VEGF signaling pathway
shon04371  Apelin signaling pathway
shon04380  Osteoclast differentiation
shon04510  Focal adhesion
shon04517  IgSF CAM signaling
shon04520  Adherens junction
shon04540  Gap junction
shon04550  Signaling pathways regulating pluripotency of stem cells
shon04611  Platelet activation
shon04613  Neutrophil extracellular trap formation
shon04620  Toll-like receptor signaling pathway
shon04621  NOD-like receptor signaling pathway
shon04625  C-type lectin receptor signaling pathway
shon04650  Natural killer cell mediated cytotoxicity
shon04657  IL-17 signaling pathway
shon04658  Th1 and Th2 cell differentiation
shon04659  Th17 cell differentiation
shon04660  T cell receptor signaling pathway
shon04662  B cell receptor signaling pathway
shon04664  Fc epsilon RI signaling pathway
shon04666  Fc gamma R-mediated phagocytosis
shon04668  TNF signaling pathway
shon04713  Circadian entrainment
shon04720  Long-term potentiation
shon04722  Neurotrophin signaling pathway
shon04723  Retrograde endocannabinoid signaling
shon04724  Glutamatergic synapse
shon04725  Cholinergic synapse
shon04726  Serotonergic synapse
shon04730  Long-term depression
shon04810  Regulation of actin cytoskeleton
shon04910  Insulin signaling pathway
shon04912  GnRH signaling pathway
shon04914  Progesterone-mediated oocyte maturation
shon04915  Estrogen signaling pathway
shon04916  Melanogenesis
shon04917  Prolactin signaling pathway
shon04919  Thyroid hormone signaling pathway
shon04921  Oxytocin signaling pathway
shon04926  Relaxin signaling pathway
shon04928  Parathyroid hormone synthesis, secretion and action
shon04929  GnRH secretion
shon04930  Type II diabetes mellitus
shon04933  AGE-RAGE signaling pathway in diabetic complications
shon04934  Cushing syndrome
shon04935  Growth hormone synthesis, secretion and action
shon04960  Aldosterone-regulated sodium reabsorption
shon05010  Alzheimer disease
shon05020  Prion disease
shon05022  Pathways of neurodegeneration - multiple diseases
shon05034  Alcoholism
shon05132  Salmonella infection
shon05133  Pertussis
shon05135  Yersinia infection
shon05140  Leishmaniasis
shon05142  Chagas disease
shon05145  Toxoplasmosis
shon05152  Tuberculosis
shon05160  Hepatitis C
shon05161  Hepatitis B
shon05163  Human cytomegalovirus infection
shon05164  Influenza A
shon05165  Human papillomavirus infection
shon05166  Human T-cell leukemia virus 1 infection
shon05167  Kaposi sarcoma-associated herpesvirus infection
shon05170  Human immunodeficiency virus 1 infection
shon05171  Coronavirus disease - COVID-19
shon05200  Pathways in cancer
shon05203  Viral carcinogenesis
shon05205  Proteoglycans in cancer
shon05206  MicroRNAs in cancer
shon05207  Chemical carcinogenesis - receptor activation
shon05208  Chemical carcinogenesis - reactive oxygen species
shon05210  Colorectal cancer
shon05211  Renal cell carcinoma
shon05212  Pancreatic cancer
shon05213  Endometrial cancer
shon05214  Glioma
shon05215  Prostate cancer
shon05216  Thyroid cancer
shon05218  Melanoma
shon05219  Bladder cancer
shon05220  Chronic myeloid leukemia
shon05221  Acute myeloid leukemia
shon05223  Non-small cell lung cancer
shon05224  Breast cancer
shon05225  Hepatocellular carcinoma
shon05226  Gastric cancer
shon05230  Central carbon metabolism in cancer
shon05231  Choline metabolism in cancer
shon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shon05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    119001903 (MAPK1)
   04012 ErbB signaling pathway
    119001903 (MAPK1)
   04014 Ras signaling pathway
    119001903 (MAPK1)
   04015 Rap1 signaling pathway
    119001903 (MAPK1)
   04350 TGF-beta signaling pathway
    119001903 (MAPK1)
   04370 VEGF signaling pathway
    119001903 (MAPK1)
   04371 Apelin signaling pathway
    119001903 (MAPK1)
   04668 TNF signaling pathway
    119001903 (MAPK1)
   04066 HIF-1 signaling pathway
    119001903 (MAPK1)
   04068 FoxO signaling pathway
    119001903 (MAPK1)
   04072 Phospholipase D signaling pathway
    119001903 (MAPK1)
   04071 Sphingolipid signaling pathway
    119001903 (MAPK1)
   04024 cAMP signaling pathway
    119001903 (MAPK1)
   04022 cGMP-PKG signaling pathway
    119001903 (MAPK1)
   04151 PI3K-Akt signaling pathway
    119001903 (MAPK1)
   04150 mTOR signaling pathway
    119001903 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    119001903 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    119001903 (MAPK1)
   04148 Efferocytosis
    119001903 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    119001903 (MAPK1)
   04210 Apoptosis
    119001903 (MAPK1)
   04218 Cellular senescence
    119001903 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    119001903 (MAPK1)
   04520 Adherens junction
    119001903 (MAPK1)
   04540 Gap junction
    119001903 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    119001903 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    119001903 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    119001903 (MAPK1)
   04613 Neutrophil extracellular trap formation
    119001903 (MAPK1)
   04620 Toll-like receptor signaling pathway
    119001903 (MAPK1)
   04621 NOD-like receptor signaling pathway
    119001903 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    119001903 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    119001903 (MAPK1)
   04660 T cell receptor signaling pathway
    119001903 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    119001903 (MAPK1)
   04659 Th17 cell differentiation
    119001903 (MAPK1)
   04657 IL-17 signaling pathway
    119001903 (MAPK1)
   04662 B cell receptor signaling pathway
    119001903 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    119001903 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    119001903 (MAPK1)
   04062 Chemokine signaling pathway
    119001903 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    119001903 (MAPK1)
   04929 GnRH secretion
    119001903 (MAPK1)
   04912 GnRH signaling pathway
    119001903 (MAPK1)
   04915 Estrogen signaling pathway
    119001903 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    119001903 (MAPK1)
   04917 Prolactin signaling pathway
    119001903 (MAPK1)
   04921 Oxytocin signaling pathway
    119001903 (MAPK1)
   04926 Relaxin signaling pathway
    119001903 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    119001903 (MAPK1)
   04919 Thyroid hormone signaling pathway
    119001903 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    119001903 (MAPK1)
   04916 Melanogenesis
    119001903 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    119001903 (MAPK1)
   04270 Vascular smooth muscle contraction
    119001903 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    119001903 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    119001903 (MAPK1)
   04725 Cholinergic synapse
    119001903 (MAPK1)
   04726 Serotonergic synapse
    119001903 (MAPK1)
   04720 Long-term potentiation
    119001903 (MAPK1)
   04730 Long-term depression
    119001903 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    119001903 (MAPK1)
   04722 Neurotrophin signaling pathway
    119001903 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    119001903 (MAPK1)
   04380 Osteoclast differentiation
    119001903 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    119001903 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    119001903 (MAPK1)
   05206 MicroRNAs in cancer
    119001903 (MAPK1)
   05205 Proteoglycans in cancer
    119001903 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    119001903 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    119001903 (MAPK1)
   05203 Viral carcinogenesis
    119001903 (MAPK1)
   05230 Central carbon metabolism in cancer
    119001903 (MAPK1)
   05231 Choline metabolism in cancer
    119001903 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    119001903 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    119001903 (MAPK1)
   05212 Pancreatic cancer
    119001903 (MAPK1)
   05225 Hepatocellular carcinoma
    119001903 (MAPK1)
   05226 Gastric cancer
    119001903 (MAPK1)
   05214 Glioma
    119001903 (MAPK1)
   05216 Thyroid cancer
    119001903 (MAPK1)
   05221 Acute myeloid leukemia
    119001903 (MAPK1)
   05220 Chronic myeloid leukemia
    119001903 (MAPK1)
   05218 Melanoma
    119001903 (MAPK1)
   05211 Renal cell carcinoma
    119001903 (MAPK1)
   05219 Bladder cancer
    119001903 (MAPK1)
   05215 Prostate cancer
    119001903 (MAPK1)
   05213 Endometrial cancer
    119001903 (MAPK1)
   05224 Breast cancer
    119001903 (MAPK1)
   05223 Non-small cell lung cancer
    119001903 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    119001903 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    119001903 (MAPK1)
   05161 Hepatitis B
    119001903 (MAPK1)
   05160 Hepatitis C
    119001903 (MAPK1)
   05171 Coronavirus disease - COVID-19
    119001903 (MAPK1)
   05164 Influenza A
    119001903 (MAPK1)
   05163 Human cytomegalovirus infection
    119001903 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    119001903 (MAPK1)
   05165 Human papillomavirus infection
    119001903 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    119001903 (MAPK1)
   05135 Yersinia infection
    119001903 (MAPK1)
   05133 Pertussis
    119001903 (MAPK1)
   05152 Tuberculosis
    119001903 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    119001903 (MAPK1)
   05140 Leishmaniasis
    119001903 (MAPK1)
   05142 Chagas disease
    119001903 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    119001903 (MAPK1)
   05020 Prion disease
    119001903 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    119001903 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    119001903 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    119001903 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    119001903 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    119001903 (MAPK1)
   04934 Cushing syndrome
    119001903 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    119001903 (MAPK1)
   01524 Platinum drug resistance
    119001903 (MAPK1)
   01522 Endocrine resistance
    119001903 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shon01001]
    119001903 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shon03036]
    119001903 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shon04147]
    119001903 (MAPK1)
Enzymes [BR:shon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     119001903 (MAPK1)
Protein kinases [BR:shon01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   119001903 (MAPK1)
Chromosome and associated proteins [BR:shon03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     119001903 (MAPK1)
Exosome [BR:shon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   119001903 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 119001903
NCBI-ProteinID: XP_036923369
LinkDB
Position
Unknown
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaacctctcttatattggcgagggtgcctacggcatggtgtgc
tctgcttatgacaatgtcaacaaagttcgagtagctatcaagaaaatcagtccttttgag
caccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacat
gagaacatcattggtatcaatgatatcattcgggcgccaaccattgagcaaatgaaagat
gtatatatagtacaggacctcatggaaacagatctctacaagctcttgaagacacaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggctgaaatatatt
cattcagcaaacgtactgcaccgtgacctcaaaccttccaacctgctgctcaacaccacc
tgtgatctcaagatatgtgattttggcttggcccgcgttgcagatccagaccatgatcac
acaggattcctgacggagtatgtagccacccgttggtacagggctccagaaattatgttg
aattccaagggctataccaagtccatcgatatttggtctgtaggctgcatcctggcagag
atgctatccaacaggcccatctttccggggaagcattatctcgaccagctgaaccacatt
ctgggtattcttggatccccatcacaggaagacctgaactgcataatcaatttaaaagct
agaaactatttgctttctctcccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgactccaaagctctggatttactggacaaaatgttgaccttcaaccctcacaag
agaattgaagtggaacaggcactggcccacccatatctggagcagtattatgacccaagt
gatgagcccattgctgaagcaccattcaagtttgacatggaattggatgacttgcctaag
gagaagctcaaagaactcatttttgaagagactgctagattccagccaggatacagatct
taa

DBGET integrated database retrieval system