Sturnira hondurensis: 119003414 Help Entry 119003414         CDS       T07222                                  Symbol CRK Name (RefSeq) adapter molecule crk isoform X1   KO K04438   C-crk adapter molecule crk Organism shon  Sturnira hondurensis Pathway shon04010   MAPK signaling pathway shon04012   ErbB signaling pathway shon04015   Rap1 signaling pathway shon04062   Chemokine signaling pathway shon04148   Efferocytosis shon04510   Focal adhesion shon04666   Fc gamma R-mediated phagocytosis shon04722   Neurotrophin signaling pathway shon04810   Regulation of actin cytoskeleton shon04910   Insulin signaling pathway shon04935   Growth hormone synthesis, secretion and action shon05100   Bacterial invasion of epithelial cells shon05135   Yersinia infection shon05163   Human cytomegalovirus infection shon05170   Human immunodeficiency virus 1 infection shon05200   Pathways in cancer shon05206   MicroRNAs in cancer shon05211   Renal cell carcinoma shon05220   Chronic myeloid leukemia Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     119003414 (CRK)    04012 ErbB signaling pathway     119003414 (CRK)    04015 Rap1 signaling pathway     119003414 (CRK)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     119003414 (CRK)   09144 Cellular community - eukaryotes    04510 Focal adhesion     119003414 (CRK)   09142 Cell motility    04810 Regulation of actin cytoskeleton     119003414 (CRK)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     119003414 (CRK)    04062 Chemokine signaling pathway     119003414 (CRK)   09152 Endocrine system    04910 Insulin signaling pathway     119003414 (CRK)    04935 Growth hormone synthesis, secretion and action     119003414 (CRK)   09156 Nervous system    04722 Neurotrophin signaling pathway     119003414 (CRK)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119003414 (CRK)    05206 MicroRNAs in cancer     119003414 (CRK)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     119003414 (CRK)    05211 Renal cell carcinoma     119003414 (CRK)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     119003414 (CRK)    05163 Human cytomegalovirus infection     119003414 (CRK)   09171 Infectious disease: bacterial    05135 Yersinia infection     119003414 (CRK)    05100 Bacterial invasion of epithelial cells     119003414 (CRK) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804 Motif Other DBs NCBI-GeneID:  119003414 NCBI-ProteinID:  XP_036925639 LinkDB All DBs Position Unknown AA seq 304 aa AA seqDB search MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD EDFS NT seq 915 nt NT seq  +upstreamnt  +downstreamnt atggcgggcaacttcgactcggaggagcggagtagctggtactgggggcggttgagccgg caggaggcggtggcgctgttgcagggccagcggcacggggttttcctggtgcgggactcg agcaccagccccggggactatgtgctcagcgtttccgagaactcgcgcgtctcccactac atcatcaacagcagcggcccgcgcccgccggtgccaccgtcgcccgcccagcctccgccc ggggtgagcccctccagactacgaataggcgatcaagagtttgattcattgcctgcttta ctggaattctacaaaatacactatttggacactacaacgttgatagaaccagtttccaga tccaggcagggtagtggagtgattctcaggcaggaggaggcagagtatgtgcgagccctc tttgactttaatgggaatgatgaagaagatcttccctttaagaaaggagacatcctgaga atccgggataagcctgaagagcagtggtggaatgcagaggacagcgaaggcaagaggggg atgattccagtcccttacgtggagaagtatagacctgcctccgcctcagtatcggctctg attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcctgggccc tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatttatgcc agggtaatccagaagcgagtccctaatgcctacgacaagacagccttggctttggaggtc ggtgaactggtaaaggttacgaagattaatgtcagtggtcagtgggaaggggagtgtaat ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcctgat gaggacttcagctga

DBGET integrated database retrieval system