Sturnira hondurensis: 119003723 Help Entry 119003723         CDS       T07222                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism shon  Sturnira hondurensis Pathway shon04060   Cytokine-cytokine receptor interaction shon04061   Viral protein interaction with cytokine and cytokine receptor shon04062   Chemokine signaling pathway shon04620   Toll-like receptor signaling pathway shon05142   Chagas disease shon05163   Human cytomegalovirus infection shon05323   Rheumatoid arthritis shon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119003723    04061 Viral protein interaction with cytokine and cytokine receptor     119003723  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     119003723    04062 Chemokine signaling pathway     119003723  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     119003723   09174 Infectious disease: parasitic    05142 Chagas disease     119003723   09163 Immune disease    05323 Rheumatoid arthritis     119003723   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119003723  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shon04052]     119003723    00536 Glycosaminoglycan binding proteins [BR:shon00536]     119003723 Cytokines and neuropeptides [BR:shon04052]  Cytokines   Chemokines    119003723 Glycosaminoglycan binding proteins [BR:shon00536]  Heparan sulfate / Heparin   Chemokines    119003723 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  119003723 NCBI-ProteinID:  XP_036926142 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MKVSGAALALLLCIAALCSQVFSAPLGADTPTACCFSYVSRPIPHQFIAKYFETSGQCSN PGIIFLTKRGREVCANPSEAWVQEYIANMELNA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccggggctgcgctggccctcctcctctgcatcgcggccctctgcagccag gtcttctcggcaccacttggcgctgacacccccacggcctgctgcttctcctatgtctcc aggccgattccacatcaattcatagccaagtattttgagaccagtggccagtgctccaat cctggcatcatcttcctaaccaaaagaggccgggaggtctgtgcgaaccccagtgaggcc tgggtccaagaatacattgccaacatggagctgaatgcctga

DBGET integrated database retrieval system