Sturnira hondurensis: 119003729 Help Entry 119003729         CDS       T07222                                  Symbol PRKCA Name (RefSeq) protein kinase C alpha type   KO K02677   classical protein kinase C alpha type [EC:2.7.11.13] Organism shon  Sturnira hondurensis Pathway shon01521   EGFR tyrosine kinase inhibitor resistance shon04010   MAPK signaling pathway shon04012   ErbB signaling pathway shon04014   Ras signaling pathway shon04015   Rap1 signaling pathway shon04020   Calcium signaling pathway shon04066   HIF-1 signaling pathway shon04070   Phosphatidylinositol signaling system shon04071   Sphingolipid signaling pathway shon04072   Phospholipase D signaling pathway shon04082   Neuroactive ligand signaling shon04150   mTOR signaling pathway shon04151   PI3K-Akt signaling pathway shon04261   Adrenergic signaling in cardiomyocytes shon04270   Vascular smooth muscle contraction shon04310   Wnt signaling pathway shon04360   Axon guidance shon04370   VEGF signaling pathway shon04510   Focal adhesion shon04540   Gap junction shon04613   Neutrophil extracellular trap formation shon04650   Natural killer cell mediated cytotoxicity shon04664   Fc epsilon RI signaling pathway shon04666   Fc gamma R-mediated phagocytosis shon04670   Leukocyte transendothelial migration shon04713   Circadian entrainment shon04720   Long-term potentiation shon04723   Retrograde endocannabinoid signaling shon04724   Glutamatergic synapse shon04725   Cholinergic synapse shon04726   Serotonergic synapse shon04727   GABAergic synapse shon04728   Dopaminergic synapse shon04730   Long-term depression shon04750   Inflammatory mediator regulation of TRP channels shon04911   Insulin secretion shon04912   GnRH signaling pathway shon04916   Melanogenesis shon04918   Thyroid hormone synthesis shon04919   Thyroid hormone signaling pathway shon04921   Oxytocin signaling pathway shon04925   Aldosterone synthesis and secretion shon04926   Relaxin signaling pathway shon04928   Parathyroid hormone synthesis, secretion and action shon04929   GnRH secretion shon04933   AGE-RAGE signaling pathway in diabetic complications shon04935   Growth hormone synthesis, secretion and action shon04960   Aldosterone-regulated sodium reabsorption shon04961   Endocrine and other factor-regulated calcium reabsorption shon04970   Salivary secretion shon04971   Gastric acid secretion shon04972   Pancreatic secretion shon05017   Spinocerebellar ataxia shon05022   Pathways of neurodegeneration - multiple diseases shon05031   Amphetamine addiction shon05032   Morphine addiction shon05143   African trypanosomiasis shon05146   Amoebiasis shon05161   Hepatitis B shon05163   Human cytomegalovirus infection shon05164   Influenza A shon05170   Human immunodeficiency virus 1 infection shon05171   Coronavirus disease - COVID-19 shon05200   Pathways in cancer shon05205   Proteoglycans in cancer shon05206   MicroRNAs in cancer shon05207   Chemical carcinogenesis - receptor activation shon05214   Glioma shon05223   Non-small cell lung cancer shon05225   Hepatocellular carcinoma shon05231   Choline metabolism in cancer shon05415   Diabetic cardiomyopathy shon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     119003729 (PRKCA)    04012 ErbB signaling pathway     119003729 (PRKCA)    04014 Ras signaling pathway     119003729 (PRKCA)    04015 Rap1 signaling pathway     119003729 (PRKCA)    04310 Wnt signaling pathway     119003729 (PRKCA)    04370 VEGF signaling pathway     119003729 (PRKCA)    04066 HIF-1 signaling pathway     119003729 (PRKCA)    04020 Calcium signaling pathway     119003729 (PRKCA)    04070 Phosphatidylinositol signaling system     119003729 (PRKCA)    04072 Phospholipase D signaling pathway     119003729 (PRKCA)    04071 Sphingolipid signaling pathway     119003729 (PRKCA)    04151 PI3K-Akt signaling pathway     119003729 (PRKCA)    04150 mTOR signaling pathway     119003729 (PRKCA)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     119003729 (PRKCA)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     119003729 (PRKCA)    04540 Gap junction     119003729 (PRKCA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     119003729 (PRKCA)    04650 Natural killer cell mediated cytotoxicity     119003729 (PRKCA)    04664 Fc epsilon RI signaling pathway     119003729 (PRKCA)    04666 Fc gamma R-mediated phagocytosis     119003729 (PRKCA)    04670 Leukocyte transendothelial migration     119003729 (PRKCA)   09152 Endocrine system    04911 Insulin secretion     119003729 (PRKCA)    04929 GnRH secretion     119003729 (PRKCA)    04912 GnRH signaling pathway     119003729 (PRKCA)    04921 Oxytocin signaling pathway     119003729 (PRKCA)    04926 Relaxin signaling pathway     119003729 (PRKCA)    04935 Growth hormone synthesis, secretion and action     119003729 (PRKCA)    04918 Thyroid hormone synthesis     119003729 (PRKCA)    04919 Thyroid hormone signaling pathway     119003729 (PRKCA)    04928 Parathyroid hormone synthesis, secretion and action     119003729 (PRKCA)    04916 Melanogenesis     119003729 (PRKCA)    04925 Aldosterone synthesis and secretion     119003729 (PRKCA)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     119003729 (PRKCA)    04270 Vascular smooth muscle contraction     119003729 (PRKCA)   09154 Digestive system    04970 Salivary secretion     119003729 (PRKCA)    04971 Gastric acid secretion     119003729 (PRKCA)    04972 Pancreatic secretion     119003729 (PRKCA)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     119003729 (PRKCA)    04961 Endocrine and other factor-regulated calcium reabsorption     119003729 (PRKCA)   09156 Nervous system    04724 Glutamatergic synapse     119003729 (PRKCA)    04727 GABAergic synapse     119003729 (PRKCA)    04725 Cholinergic synapse     119003729 (PRKCA)    04728 Dopaminergic synapse     119003729 (PRKCA)    04726 Serotonergic synapse     119003729 (PRKCA)    04720 Long-term potentiation     119003729 (PRKCA)    04730 Long-term depression     119003729 (PRKCA)    04723 Retrograde endocannabinoid signaling     119003729 (PRKCA)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     119003729 (PRKCA)   09158 Development and regeneration    04360 Axon guidance     119003729 (PRKCA)   09159 Environmental adaptation    04713 Circadian entrainment     119003729 (PRKCA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119003729 (PRKCA)    05206 MicroRNAs in cancer     119003729 (PRKCA)    05205 Proteoglycans in cancer     119003729 (PRKCA)    05207 Chemical carcinogenesis - receptor activation     119003729 (PRKCA)    05231 Choline metabolism in cancer     119003729 (PRKCA)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     119003729 (PRKCA)    05214 Glioma     119003729 (PRKCA)    05223 Non-small cell lung cancer     119003729 (PRKCA)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     119003729 (PRKCA)    05161 Hepatitis B     119003729 (PRKCA)    05171 Coronavirus disease - COVID-19     119003729 (PRKCA)    05164 Influenza A     119003729 (PRKCA)    05163 Human cytomegalovirus infection     119003729 (PRKCA)   09174 Infectious disease: parasitic    05146 Amoebiasis     119003729 (PRKCA)    05143 African trypanosomiasis     119003729 (PRKCA)   09164 Neurodegenerative disease    05017 Spinocerebellar ataxia     119003729 (PRKCA)    05022 Pathways of neurodegeneration - multiple diseases     119003729 (PRKCA)   09165 Substance dependence    05031 Amphetamine addiction     119003729 (PRKCA)    05032 Morphine addiction     119003729 (PRKCA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119003729 (PRKCA)    05415 Diabetic cardiomyopathy     119003729 (PRKCA)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     119003729 (PRKCA)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     119003729 (PRKCA)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:shon01001]     119003729 (PRKCA)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shon04131]     119003729 (PRKCA) Enzymes [BR:shon01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.13  protein kinase C      119003729 (PRKCA) Protein kinases [BR:shon01001]  Serine/threonine kinases: AGC group   PKC family [OT]    119003729 (PRKCA) Membrane trafficking [BR:shon04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     119003729 (PRKCA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C ABC1 C1_2 Kinase-like Motif Other DBs NCBI-GeneID:  119003729 NCBI-ProteinID:  XP_036926165 LinkDB All DBs Position Unknown AA seq 670 aa AA seqDB search MADVFPANDSTAPQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVQDA KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL SIEIWDWDRTTRNDFMGSLSFGVSELMKMPACGWYKLLNQEEGEYYNVPIPEGDDEGNME LRQKFEKAKLGPAKKVISPSEDRRFSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTE ELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNG GDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKKGIIYRDLKLDNVMLDSEGHIKIADF GMCKEHMMEGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGED EDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRIDW EKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQ FVHPILQSAV NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt atggctgacgttttcccggccaacgactccacggcgcctcaggacgtggccaaccgcttt gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt ggaaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgaa tttgtcacattttcttgtccgggtgcggacaagggacccgacactgacgaccccaggagc aagcacaagttcaaaatccacacctatggcagccccaccttctgtgaccactgcgggtcg ctgctgtacggactcatccatcaggggatgaaatgcgacacctgcgacatgaacgtgcac aagcagtgcgtcataaacgtccccagcctctgtgggatggaccacaccgagaagaggggc cggatctacctgaaggctgaggtcgctgatgaaaagctccatgtcacagtgcaagatgca aaaaatctaatccccatggatccaaatggactttcagacccttacgtgaagctgaaactt attcctgatcccaagaatgaaagcaaacaaaaaaccaaaactatccgctccacactaaac ccccagtggaacgagtccttcacgttcaaattaaaaccttcagataaagaccgacgactg tccatagaaatctgggactgggatcggacaacaaggaacgacttcatgggatccctttcc ttcggcgtttcagagctgatgaagatgccggcctgtgggtggtacaagctgctcaaccaa gaagaaggtgaatattacaacgtgcccattccagaaggagacgacgaaggaaacatggaa ctcaggcagaaattcgagaaagccaagcttggccccgccaagaaagtgatcagtccttca gaagataggagattttccaacaacctggacagagtgaaactcactgacttcaatttcctc atggtgctggggaaggggagcttcggaaaggtgatgctggctgacaggaagggaacggaa gagctctatgccatcaagatcctgaagaaggacgtggtgattcaggacgacgatgtggag tgcaccatggtggaaaagcgagtcctggccctgctcgacaagcccccgttcctgacccag ctgcactcctgcttccagacagtggaccggctgtacttcgtcatggaatacgtcaacggc ggggacctcatgtaccacattcagcaagtaggaaaattcaaggagccacaggcagtattc tatgcagcagagatttccattggattgttctttcttcataaaaaaggaatcatttatagg gacctgaagttagacaatgtcatgctggactcggaagggcacatcaagattgctgacttc gggatgtgcaaggagcacatgatggagggggtcacgaccagaaccttctgtgggacccca gattacatcgccccagagatcattgcctaccagccgtatgggaagtccgtggactggtgg gcctatggcgtcctgctgtatgaaatgctggccggacagcctccgtttgacggtgaagac gaagacgagctcttccagtccatcatggagcacaacgtctcgtacccgaaatccctgtcc aaggaggctgtttccatctgcaaaggactgatgaccaaacacccaggcaagcggctgggc tgcgggcccgagggcgagcgggacgtgcgcgaacacgccttcttccggaggatcgactgg gagaaactggagaacagggagatccagccgcccttcaagcctaaagtgtgcggcaaaggg gcggaaaactttgacaagttcttcacacgagggcaaccggtcttaacgcctccggatcag ctggtcatcgctaacatagaccagtctgattttgaggggttctcctacgtcaacccccag tttgtgcaccccatcttacagagcgcagtatga

DBGET integrated database retrieval system