Sturnira hondurensis: 119004015 Help Entry 119004015         CDS       T07222                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism shon  Sturnira hondurensis Pathway shon04014   Ras signaling pathway shon04137   Mitophagy - animal shon04144   Endocytosis shon04145   Phagosome shon04148   Efferocytosis shon04962   Vasopressin-regulated water reabsorption shon05014   Amyotrophic lateral sclerosis shon05022   Pathways of neurodegeneration - multiple diseases shon05132   Salmonella infection shon05146   Amoebiasis shon05152   Tuberculosis Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     119004015 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     119004015 (RAB5A)    04145 Phagosome     119004015 (RAB5A)    04137 Mitophagy - animal     119004015 (RAB5A)    04148 Efferocytosis     119004015 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     119004015 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119004015 (RAB5A)    05152 Tuberculosis     119004015 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     119004015 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     119004015 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     119004015 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shon04131]     119004015 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shon04147]     119004015 (RAB5A)    04031 GTP-binding proteins [BR:shon04031]     119004015 (RAB5A) Membrane trafficking [BR:shon04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     119004015 (RAB5A)  Endosome - Lysosome transport     119004015 (RAB5A) Exosome [BR:shon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119004015 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    119004015 (RAB5A)   Exosomal proteins of colorectal cancer cells    119004015 (RAB5A)   Exosomal proteins of bladder cancer cells    119004015 (RAB5A) GTP-binding proteins [BR:shon04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     119004015 (RAB5A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  119004015 NCBI-ProteinID:  XP_036926582 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt gtgaaaggccaatttcatgaatttcaagagagtaccatcggggctgcttttctaacccaa actgtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat gatatcacaaatgaggaatcctttgccagagccaaaaattgggttaaagaacttcagagg caagccagtcctaacattgtaatagctttatctggaaacaaggctgaccttgcaaataaa agagctgttgacttccaggaagcacagtcttatgcagatgacaacagtttattattcatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaagaag ttgccaaagaatgaaccgcagaatccaggagcaaactctgcccggggaagaggagtagac cttactgagcccacgcagccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system