Shewanella putrefaciens 200: Sput200_3407 Help Entry Sput200_3407      CDS       T02015                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism shp  Shewanella putrefaciens 200 Pathway shp02024   Quorum sensing shp03018   RNA degradation Brite KEGG Orthology (KO) [BR:shp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Sput200_3407  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Sput200_3407  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:shp03019]     Sput200_3407    03036 Chromosome and associated proteins [BR:shp03036]     Sput200_3407 Messenger RNA biogenesis [BR:shp03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Sput200_3407 Chromosome and associated proteins [BR:shp03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Sput200_3407 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Staphylcoagulse Motif Other DBs NCBI-ProteinID:  ADV55796 UniProt:  E6XNH1 LinkDB All DBs Position complement(3871786..3872058) Genome browser AA seq 90 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNSIKLQGQVESFDQFVILLKNTVSQMVYKHAIS TVVPARPFNVTGHQNAQGGYGPQDDVPSGE NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagacccatttttgaacgcactacgccgcgagcgcgtt cctgtatcaatttacttagtaaacagcattaaactccaaggacaggtagagtcgtttgat caatttgtcattctgttgaaaaacacagtgagccaaatggtatacaagcacgctatttct acggttgttcctgctcgcccattcaatgtcactggtcaccaaaatgcccagggtggatat ggtccgcaagacgatgtacctagtggcgaataa

DBGET integrated database retrieval system