Shigella sp. PAMC 28760: A0259_05870 Help Entry A0259_05870       CDS       T04390                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism shq  Shigella sp. PAMC 28760 Brite KEGG Orthology (KO) [BR:shq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:shq03032]     A0259_05870    03036 Chromosome and associated proteins [BR:shq03036]     A0259_05870    03400 DNA repair and recombination proteins [BR:shq03400]     A0259_05870 DNA replication proteins [BR:shq03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     A0259_05870 Chromosome and associated proteins [BR:shq03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     A0259_05870 DNA repair and recombination proteins [BR:shq03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       A0259_05870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AMR22196 LinkDB All DBs Position 1210612..1210884 Genome browser AA seq 90 aa AA seqDB search MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKERAARTG RNPQTGKEITIAAAKVPSFRAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataaatctcaattgatcgacaagattgctgcaggggctgatatctctaaagctgcg gctggccgtgcgttagatgctattattgcttccgtaactgaatctctgaaagaaggggat gatgtagcactggtaggttttggtacttttgccgttaaagagcgtgctgcccgtactggc cgcaacccgcagaccggtaaagagatcaccatcgctgctgctaaagtaccgagcttccgt gcaggtaaagcactgaaagacgcggtaaactaa

DBGET integrated database retrieval system