Shigella sp. PAMC 28760: A0259_07980 Help Entry A0259_07980       CDS       T04390                                  Name (GenBank) hypothetical protein   KO K13650   MqsR-controlled colanic acid and biofilm protein A Organism shq  Shigella sp. PAMC 28760 Brite KEGG Orthology (KO) [BR:shq00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02048 Prokaryotic defense system [BR:shq02048]     A0259_07980 Prokaryotic defense system [BR:shq02048]  Toxin-antitoxin system (TA system)   Type II TA system    Type II TA system related factors     A0259_07980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YdgH_BhsA-like DNA_Packaging_2 Motif Other DBs NCBI-ProteinID:  AMR22567 LinkDB All DBs Position complement(1605915..1606175) Genome browser AA seq 86 aa AA seqDB search MKKCLTLLIATVLSGISLTAYAAQPMSNLDSGQLRPAGTVSATGASNLSDLEDKLAEKAR EQGAKGYVINSAGGNDQMFGTATIYK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaaaaagtgcctcacactactgattgccaccgtcctgagcggaatctctctcacggct tatgccgcgcaaccgatgagtaacctggacagcggtcagctacggcccgccggtaccgtt tcggcaactggcgcatcaaacctaagcgatctggaggataaactggcagaaaaagcgcgc gaacaaggcgcgaaaggttatgtcattaattccgcaggcggaaatgaccagatgttcggt actgcaaccatctacaaataa

DBGET integrated database retrieval system