KEGG   Sarcophilus harrisii (Tasmanian devil): 100913231
Entry
100913231         CDS       T02286                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr01524  Platinum drug resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04022  cGMP-PKG signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04114  Oocyte meiosis
shr04140  Autophagy - animal
shr04148  Efferocytosis
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04218  Cellular senescence
shr04261  Adrenergic signaling in cardiomyocytes
shr04270  Vascular smooth muscle contraction
shr04350  TGF-beta signaling pathway
shr04360  Axon guidance
shr04370  VEGF signaling pathway
shr04371  Apelin signaling pathway
shr04380  Osteoclast differentiation
shr04510  Focal adhesion
shr04520  Adherens junction
shr04540  Gap junction
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04611  Platelet activation
shr04613  Neutrophil extracellular trap formation
shr04620  Toll-like receptor signaling pathway
shr04621  NOD-like receptor signaling pathway
shr04625  C-type lectin receptor signaling pathway
shr04650  Natural killer cell mediated cytotoxicity
shr04657  IL-17 signaling pathway
shr04658  Th1 and Th2 cell differentiation
shr04659  Th17 cell differentiation
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04668  TNF signaling pathway
shr04713  Circadian entrainment
shr04720  Long-term potentiation
shr04722  Neurotrophin signaling pathway
shr04723  Retrograde endocannabinoid signaling
shr04724  Glutamatergic synapse
shr04725  Cholinergic synapse
shr04726  Serotonergic synapse
shr04730  Long-term depression
shr04810  Regulation of actin cytoskeleton
shr04910  Insulin signaling pathway
shr04912  GnRH signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04916  Melanogenesis
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04921  Oxytocin signaling pathway
shr04926  Relaxin signaling pathway
shr04928  Parathyroid hormone synthesis, secretion and action
shr04929  GnRH secretion
shr04930  Type II diabetes mellitus
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04934  Cushing syndrome
shr04935  Growth hormone synthesis, secretion and action
shr04960  Aldosterone-regulated sodium reabsorption
shr05010  Alzheimer disease
shr05020  Prion disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05034  Alcoholism
shr05132  Salmonella infection
shr05133  Pertussis
shr05135  Yersinia infection
shr05140  Leishmaniasis
shr05142  Chagas disease
shr05145  Toxoplasmosis
shr05152  Tuberculosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05170  Human immunodeficiency virus 1 infection
shr05171  Coronavirus disease - COVID-19
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05207  Chemical carcinogenesis - receptor activation
shr05208  Chemical carcinogenesis - reactive oxygen species
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05216  Thyroid cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100913231 (MAPK1)
   04012 ErbB signaling pathway
    100913231 (MAPK1)
   04014 Ras signaling pathway
    100913231 (MAPK1)
   04015 Rap1 signaling pathway
    100913231 (MAPK1)
   04350 TGF-beta signaling pathway
    100913231 (MAPK1)
   04370 VEGF signaling pathway
    100913231 (MAPK1)
   04371 Apelin signaling pathway
    100913231 (MAPK1)
   04668 TNF signaling pathway
    100913231 (MAPK1)
   04066 HIF-1 signaling pathway
    100913231 (MAPK1)
   04068 FoxO signaling pathway
    100913231 (MAPK1)
   04072 Phospholipase D signaling pathway
    100913231 (MAPK1)
   04071 Sphingolipid signaling pathway
    100913231 (MAPK1)
   04024 cAMP signaling pathway
    100913231 (MAPK1)
   04022 cGMP-PKG signaling pathway
    100913231 (MAPK1)
   04151 PI3K-Akt signaling pathway
    100913231 (MAPK1)
   04150 mTOR signaling pathway
    100913231 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100913231 (MAPK1)
   04148 Efferocytosis
    100913231 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100913231 (MAPK1)
   04210 Apoptosis
    100913231 (MAPK1)
   04218 Cellular senescence
    100913231 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100913231 (MAPK1)
   04520 Adherens junction
    100913231 (MAPK1)
   04540 Gap junction
    100913231 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100913231 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100913231 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100913231 (MAPK1)
   04613 Neutrophil extracellular trap formation
    100913231 (MAPK1)
   04620 Toll-like receptor signaling pathway
    100913231 (MAPK1)
   04621 NOD-like receptor signaling pathway
    100913231 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    100913231 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    100913231 (MAPK1)
   04660 T cell receptor signaling pathway
    100913231 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    100913231 (MAPK1)
   04659 Th17 cell differentiation
    100913231 (MAPK1)
   04657 IL-17 signaling pathway
    100913231 (MAPK1)
   04662 B cell receptor signaling pathway
    100913231 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    100913231 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    100913231 (MAPK1)
   04062 Chemokine signaling pathway
    100913231 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100913231 (MAPK1)
   04929 GnRH secretion
    100913231 (MAPK1)
   04912 GnRH signaling pathway
    100913231 (MAPK1)
   04915 Estrogen signaling pathway
    100913231 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    100913231 (MAPK1)
   04917 Prolactin signaling pathway
    100913231 (MAPK1)
   04921 Oxytocin signaling pathway
    100913231 (MAPK1)
   04926 Relaxin signaling pathway
    100913231 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    100913231 (MAPK1)
   04919 Thyroid hormone signaling pathway
    100913231 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    100913231 (MAPK1)
   04916 Melanogenesis
    100913231 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100913231 (MAPK1)
   04270 Vascular smooth muscle contraction
    100913231 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100913231 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100913231 (MAPK1)
   04725 Cholinergic synapse
    100913231 (MAPK1)
   04726 Serotonergic synapse
    100913231 (MAPK1)
   04720 Long-term potentiation
    100913231 (MAPK1)
   04730 Long-term depression
    100913231 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    100913231 (MAPK1)
   04722 Neurotrophin signaling pathway
    100913231 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    100913231 (MAPK1)
   04380 Osteoclast differentiation
    100913231 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100913231 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100913231 (MAPK1)
   05206 MicroRNAs in cancer
    100913231 (MAPK1)
   05205 Proteoglycans in cancer
    100913231 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    100913231 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    100913231 (MAPK1)
   05203 Viral carcinogenesis
    100913231 (MAPK1)
   05230 Central carbon metabolism in cancer
    100913231 (MAPK1)
   05231 Choline metabolism in cancer
    100913231 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100913231 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100913231 (MAPK1)
   05212 Pancreatic cancer
    100913231 (MAPK1)
   05225 Hepatocellular carcinoma
    100913231 (MAPK1)
   05226 Gastric cancer
    100913231 (MAPK1)
   05214 Glioma
    100913231 (MAPK1)
   05216 Thyroid cancer
    100913231 (MAPK1)
   05221 Acute myeloid leukemia
    100913231 (MAPK1)
   05220 Chronic myeloid leukemia
    100913231 (MAPK1)
   05218 Melanoma
    100913231 (MAPK1)
   05211 Renal cell carcinoma
    100913231 (MAPK1)
   05219 Bladder cancer
    100913231 (MAPK1)
   05215 Prostate cancer
    100913231 (MAPK1)
   05213 Endometrial cancer
    100913231 (MAPK1)
   05224 Breast cancer
    100913231 (MAPK1)
   05223 Non-small cell lung cancer
    100913231 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100913231 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    100913231 (MAPK1)
   05161 Hepatitis B
    100913231 (MAPK1)
   05160 Hepatitis C
    100913231 (MAPK1)
   05171 Coronavirus disease - COVID-19
    100913231 (MAPK1)
   05164 Influenza A
    100913231 (MAPK1)
   05163 Human cytomegalovirus infection
    100913231 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100913231 (MAPK1)
   05165 Human papillomavirus infection
    100913231 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100913231 (MAPK1)
   05135 Yersinia infection
    100913231 (MAPK1)
   05133 Pertussis
    100913231 (MAPK1)
   05152 Tuberculosis
    100913231 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100913231 (MAPK1)
   05140 Leishmaniasis
    100913231 (MAPK1)
   05142 Chagas disease
    100913231 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100913231 (MAPK1)
   05020 Prion disease
    100913231 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    100913231 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    100913231 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100913231 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100913231 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100913231 (MAPK1)
   04934 Cushing syndrome
    100913231 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100913231 (MAPK1)
   01524 Platinum drug resistance
    100913231 (MAPK1)
   01522 Endocrine resistance
    100913231 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100913231 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shr03036]
    100913231 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100913231 (MAPK1)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100913231 (MAPK1)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100913231 (MAPK1)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100913231 (MAPK1)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100913231 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kinase-like Kdo
Other DBs
NCBI-GeneID: 100913231
NCBI-ProteinID: XP_031804906
Ensembl: ENSSHAG00000007720
LinkDB
Position
1:712858026..712907433
AA seq 361 aa
MAAAAGGGGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPF
EHQTYCQRTLREIKILLRFRHENIIGINDIIRAPAIEQMKDVYIVQDLMETDLYKLLKTQ
HLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHD
HTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNH
ILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPKALDLLDKMLTFNPH
KRIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYR
S
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgggaggcggcggcgcggggcccgagatggtccgcgggcaggtgttc
gacgtgggcccgcgctacaccaacctctcctacatcggcgagggcgcctacggcatggtg
tgttccgcgtatgacaatgtcaacaaagtccgagtggccatcaagaaaatcagccccttt
gagcaccagacctactgccagcggactctgcgtgagatcaagatcttgctgcgcttccgc
catgagaacatcatcggcatcaacgacatcatccgggccccggccattgagcagatgaaa
gatgtatacattgtccaggacctcatggagacagacctttacaagctcttaaagacgcag
cacctcagcaacgaccacatctgttatttcctttatcagatcttaagaggtttgaaatac
atccattcagccaatgttctgcaccgggacctcaagccttccaacctgctactcaacacc
acctgcgatctcaagatctgtgactttggcttggctcgtgttgcagatccagaccatgac
cacacaggcttcctgacggaatatgtggccacacgctggtatcgagcacctgaaattatg
ctgaattccaagggttacaccaagtccattgacatctggtctgtgggctgtatcctggcg
gagatgctctccaatagacccattttccctggaaaacattacctagatcagctgaaccat
attcttggcattcttggatccccgtcacaagaagacttgaattgcataatcaacttaaaa
gccaggaactatttgctctctcttcctcacaaaaacaaggtgccatggaatagactcttc
cccaacgctgaccccaaagctctggatttgttggataagatgctgacatttaaccctcac
aagaggattgaggtggagcaggcgctagcccatccctacctggagcagtattatgaccca
agtgatgagccggtcgccgaagccccgttcaagtttgacatggaactggatgatctgccc
aaggagaagctgaaagaactgatctttgaagagacggctcgattccagcctggataccga
tcttaa

DBGET integrated database retrieval system