Sarcophilus harrisii (Tasmanian devil): 100914079 Help Entry 100914079         CDS       T02286                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr03030   DNA replication shr03410   Base excision repair shr03420   Nucleotide excision repair shr03430   Mismatch repair shr03440   Homologous recombination Brite KEGG Orthology (KO) [BR:shr00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     100914079 (POLD4)    03410 Base excision repair     100914079 (POLD4)    03420 Nucleotide excision repair     100914079 (POLD4)    03430 Mismatch repair     100914079 (POLD4)    03440 Homologous recombination     100914079 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:shr03032]     100914079 (POLD4)    03400 DNA repair and recombination proteins [BR:shr03400]     100914079 (POLD4) DNA replication proteins [BR:shr03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     100914079 (POLD4) DNA repair and recombination proteins [BR:shr03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       100914079 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      100914079 (POLD4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  100914079 NCBI-ProteinID:  XP_031799116 LinkDB All DBs Position 6:240375529..240377269 Genome browser AA seq 115 aa AA seqDB search MGRKRRLITDSFPKVKRRKGGPGPGKEDPEPEPGLRGEESGEEPLAPLEDKTHLELLRQF DLDRHFGPCTGITRLQRWERAEQLGLGPPHEVLKVLWAHPGDPQYQCSLWHLYPI NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgggccggaagaggaggctcatcaccgactccttccccaaagtgaagaggaggaagggc gggccggggcctggcaaggaggacccggagcccgagccagggctgcgaggggaggagtcg ggggaggagccgctcgcacccctggaggacaaaactcatttagagctactgaggcagttt gacctggacaggcacttcggcccctgcacagggatcactcggcttcagcgctgggagcgg gcagagcagctgggcctgggccctccccatgaggtgctcaaggtgctgtgggcccaccct ggagacccccagtaccagtgcagcctctggcacctgtaccccatctaa

DBGET integrated database retrieval system