Sarcophilus harrisii (Tasmanian devil): 100914703 Help Entry 100914703         CDS       T02286                                  Name (RefSeq) interferon tau-2-like   KO K05414   interferon alpha Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04060   Cytokine-cytokine receptor interaction shr04151   PI3K-Akt signaling pathway shr04217   Necroptosis shr04620   Toll-like receptor signaling pathway shr04621   NOD-like receptor signaling pathway shr04622   RIG-I-like receptor signaling pathway shr04623   Cytosolic DNA-sensing pathway shr04630   JAK-STAT signaling pathway shr04650   Natural killer cell mediated cytotoxicity shr04936   Alcoholic liver disease shr05152   Tuberculosis shr05160   Hepatitis C shr05161   Hepatitis B shr05162   Measles shr05163   Human cytomegalovirus infection shr05164   Influenza A shr05165   Human papillomavirus infection shr05167   Kaposi sarcoma-associated herpesvirus infection shr05168   Herpes simplex virus 1 infection shr05169   Epstein-Barr virus infection shr05170   Human immunodeficiency virus 1 infection shr05171   Coronavirus disease - COVID-19 shr05200   Pathways in cancer shr05320   Autoimmune thyroid disease shr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100914703    04151 PI3K-Akt signaling pathway     100914703   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100914703  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100914703  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100914703    04621 NOD-like receptor signaling pathway     100914703    04622 RIG-I-like receptor signaling pathway     100914703    04623 Cytosolic DNA-sensing pathway     100914703    04650 Natural killer cell mediated cytotoxicity     100914703  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100914703   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100914703    05161 Hepatitis B     100914703    05160 Hepatitis C     100914703    05171 Coronavirus disease - COVID-19     100914703    05164 Influenza A     100914703    05162 Measles     100914703    05168 Herpes simplex virus 1 infection     100914703    05163 Human cytomegalovirus infection     100914703    05167 Kaposi sarcoma-associated herpesvirus infection     100914703    05169 Epstein-Barr virus infection     100914703    05165 Human papillomavirus infection     100914703   09171 Infectious disease: bacterial    05152 Tuberculosis     100914703   09163 Immune disease    05320 Autoimmune thyroid disease     100914703   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100914703   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100914703  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shr04052]     100914703 Cytokines and neuropeptides [BR:shr04052]  Cytokines   Interferons    100914703 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100914703 NCBI-ProteinID:  XP_003761437 LinkDB All DBs Position 1:211431766..211432317 Genome browser AA seq 183 aa AA seqDB search MMSWTLLPVALVLLCSSTLCSLGCDLTQGLQEDFSFLNQISVFSLLPCLKDRTNFTFPKE AMEGSQLQRENTTVMVHETLQQIFTIFSLNTTPAAWNQTQLRQLLIGLDQQLEQLEQCVG QEAEQEEPSLGSENPILVLKSYFQGIRAYLQGKEYSRCAWEIVRVEIRRIFLFMSKLTKK LKN NT seq 552 nt NT seq  +upstreamnt  +downstreamnt atgatgtcctggaccttgttacccgttgccctggttctgctctgctccagcaccctctgc tccctgggctgtgacctgactcagggcctgcaggaagacttctcttttttgaaccaaata agtgtattttccctgctgccatgtctgaaggacaggaccaacttcaccttcccaaaggaa gccatggagggcagccagctccagagggaaaataccacagtcatggttcatgagaccctc cagcagattttcaccatcttcagcctgaataccactcctgctgcttggaatcagacccag ctcaggcaactgctcattggactggatcagcaactggaacagctggagcagtgtgttggg caggaggcggagcaggaagagccttccttgggaagtgagaaccccatactggtcctgaag agctactttcaagggataagggcatatctgcaaggcaaagagtacagccgctgtgcctgg gaaattgtgagagtagagatcaggaggatcttcctgttcatgagcaaactcacaaaaaaa cttaaaaattaa

DBGET integrated database retrieval system