KEGG   Sarcophilus harrisii (Tasmanian devil): 100915526
Entry
100915526         CDS       T02286                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04062  Chemokine signaling pathway
shr04068  FoxO signaling pathway
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04137  Mitophagy - animal
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04218  Cellular senescence
shr04360  Axon guidance
shr04370  VEGF signaling pathway
shr04371  Apelin signaling pathway
shr04540  Gap junction
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04625  C-type lectin receptor signaling pathway
shr04650  Natural killer cell mediated cytotoxicity
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04714  Thermogenesis
shr04720  Long-term potentiation
shr04722  Neurotrophin signaling pathway
shr04725  Cholinergic synapse
shr04726  Serotonergic synapse
shr04730  Long-term depression
shr04810  Regulation of actin cytoskeleton
shr04910  Insulin signaling pathway
shr04912  GnRH signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04916  Melanogenesis
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04921  Oxytocin signaling pathway
shr04926  Relaxin signaling pathway
shr04929  GnRH secretion
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr04960  Aldosterone-regulated sodium reabsorption
shr05010  Alzheimer disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05034  Alcoholism
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05207  Chemical carcinogenesis - receptor activation
shr05208  Chemical carcinogenesis - reactive oxygen species
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05216  Thyroid cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100915526 (KRAS)
   04012 ErbB signaling pathway
    100915526 (KRAS)
   04014 Ras signaling pathway
    100915526 (KRAS)
   04015 Rap1 signaling pathway
    100915526 (KRAS)
   04370 VEGF signaling pathway
    100915526 (KRAS)
   04371 Apelin signaling pathway
    100915526 (KRAS)
   04068 FoxO signaling pathway
    100915526 (KRAS)
   04072 Phospholipase D signaling pathway
    100915526 (KRAS)
   04071 Sphingolipid signaling pathway
    100915526 (KRAS)
   04151 PI3K-Akt signaling pathway
    100915526 (KRAS)
   04150 mTOR signaling pathway
    100915526 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100915526 (KRAS)
   04137 Mitophagy - animal
    100915526 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    100915526 (KRAS)
   04218 Cellular senescence
    100915526 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100915526 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    100915526 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100915526 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100915526 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    100915526 (KRAS)
   04660 T cell receptor signaling pathway
    100915526 (KRAS)
   04662 B cell receptor signaling pathway
    100915526 (KRAS)
   04664 Fc epsilon RI signaling pathway
    100915526 (KRAS)
   04062 Chemokine signaling pathway
    100915526 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100915526 (KRAS)
   04929 GnRH secretion
    100915526 (KRAS)
   04912 GnRH signaling pathway
    100915526 (KRAS)
   04915 Estrogen signaling pathway
    100915526 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    100915526 (KRAS)
   04917 Prolactin signaling pathway
    100915526 (KRAS)
   04921 Oxytocin signaling pathway
    100915526 (KRAS)
   04926 Relaxin signaling pathway
    100915526 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    100915526 (KRAS)
   04919 Thyroid hormone signaling pathway
    100915526 (KRAS)
   04916 Melanogenesis
    100915526 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100915526 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    100915526 (KRAS)
   04726 Serotonergic synapse
    100915526 (KRAS)
   04720 Long-term potentiation
    100915526 (KRAS)
   04730 Long-term depression
    100915526 (KRAS)
   04722 Neurotrophin signaling pathway
    100915526 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    100915526 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    100915526 (KRAS)
   04213 Longevity regulating pathway - multiple species
    100915526 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    100915526 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100915526 (KRAS)
   05206 MicroRNAs in cancer
    100915526 (KRAS)
   05205 Proteoglycans in cancer
    100915526 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    100915526 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    100915526 (KRAS)
   05203 Viral carcinogenesis
    100915526 (KRAS)
   05230 Central carbon metabolism in cancer
    100915526 (KRAS)
   05231 Choline metabolism in cancer
    100915526 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100915526 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100915526 (KRAS)
   05212 Pancreatic cancer
    100915526 (KRAS)
   05225 Hepatocellular carcinoma
    100915526 (KRAS)
   05226 Gastric cancer
    100915526 (KRAS)
   05214 Glioma
    100915526 (KRAS)
   05216 Thyroid cancer
    100915526 (KRAS)
   05221 Acute myeloid leukemia
    100915526 (KRAS)
   05220 Chronic myeloid leukemia
    100915526 (KRAS)
   05218 Melanoma
    100915526 (KRAS)
   05211 Renal cell carcinoma
    100915526 (KRAS)
   05219 Bladder cancer
    100915526 (KRAS)
   05215 Prostate cancer
    100915526 (KRAS)
   05213 Endometrial cancer
    100915526 (KRAS)
   05224 Breast cancer
    100915526 (KRAS)
   05223 Non-small cell lung cancer
    100915526 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100915526 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    100915526 (KRAS)
   05161 Hepatitis B
    100915526 (KRAS)
   05160 Hepatitis C
    100915526 (KRAS)
   05163 Human cytomegalovirus infection
    100915526 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100915526 (KRAS)
   05165 Human papillomavirus infection
    100915526 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100915526 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    100915526 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    100915526 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100915526 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100915526 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100915526 (KRAS)
   01522 Endocrine resistance
    100915526 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100915526 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:shr04031]
    100915526 (KRAS)
Membrane trafficking [BR:shr04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100915526 (KRAS)
GTP-binding proteins [BR:shr04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100915526 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin
Other DBs
NCBI-GeneID: 100915526
NCBI-ProteinID: XP_012406311
Ensembl: ENSSHAG00000006631
UniProt: A0A7N4PG33
LinkDB
Position
5:complement(120012519..120051999)
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKITKEEKTPGC
VKIKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataagcttgtggtagttggagctggtggcgtaggcaagagtgccttgaca
atacagctaattcagaatcactttgtagatgagtatgatcctacaatagaggattcctac
aggaaacaagtagtaattgatggagagacctgtctcttggatattctcgacacagcaggt
caagaggaatacagtgcaatgagggaccagtacatgaggactggggagggatttctatgt
gtatttgccataaataatactaagtcgtttgaagatattcaccattatagagaacaaata
aaaagagttaaagattctgaagatgtacccatggtccttgtaggaaataaatgtgattta
ccttccagaacagtagatacaaaacaagctcaggacttagcaagaagttatggaattcct
ttcattgaaacatcagcaaaaacaagacagagagtggaggatgctttttatacattggtg
agagagattcggcaatacagattgaaaaaaatcaccaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattgtaatgtaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100927252
Entry
100927252         CDS       T02286                                 
Name
(RefSeq) ras-related protein Rab-26-like
  KO
K07827  GTPase KRas
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04062  Chemokine signaling pathway
shr04068  FoxO signaling pathway
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04137  Mitophagy - animal
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04218  Cellular senescence
shr04360  Axon guidance
shr04370  VEGF signaling pathway
shr04371  Apelin signaling pathway
shr04540  Gap junction
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04625  C-type lectin receptor signaling pathway
shr04650  Natural killer cell mediated cytotoxicity
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04714  Thermogenesis
shr04720  Long-term potentiation
shr04722  Neurotrophin signaling pathway
shr04725  Cholinergic synapse
shr04726  Serotonergic synapse
shr04730  Long-term depression
shr04810  Regulation of actin cytoskeleton
shr04910  Insulin signaling pathway
shr04912  GnRH signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04916  Melanogenesis
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04921  Oxytocin signaling pathway
shr04926  Relaxin signaling pathway
shr04929  GnRH secretion
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr04960  Aldosterone-regulated sodium reabsorption
shr05010  Alzheimer disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05034  Alcoholism
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05207  Chemical carcinogenesis - receptor activation
shr05208  Chemical carcinogenesis - reactive oxygen species
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05216  Thyroid cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100927252
   04012 ErbB signaling pathway
    100927252
   04014 Ras signaling pathway
    100927252
   04015 Rap1 signaling pathway
    100927252
   04370 VEGF signaling pathway
    100927252
   04371 Apelin signaling pathway
    100927252
   04068 FoxO signaling pathway
    100927252
   04072 Phospholipase D signaling pathway
    100927252
   04071 Sphingolipid signaling pathway
    100927252
   04151 PI3K-Akt signaling pathway
    100927252
   04150 mTOR signaling pathway
    100927252
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100927252
   04137 Mitophagy - animal
    100927252
  09143 Cell growth and death
   04210 Apoptosis
    100927252
   04218 Cellular senescence
    100927252
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100927252
   04550 Signaling pathways regulating pluripotency of stem cells
    100927252
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100927252
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100927252
   04650 Natural killer cell mediated cytotoxicity
    100927252
   04660 T cell receptor signaling pathway
    100927252
   04662 B cell receptor signaling pathway
    100927252
   04664 Fc epsilon RI signaling pathway
    100927252
   04062 Chemokine signaling pathway
    100927252
  09152 Endocrine system
   04910 Insulin signaling pathway
    100927252
   04929 GnRH secretion
    100927252
   04912 GnRH signaling pathway
    100927252
   04915 Estrogen signaling pathway
    100927252
   04914 Progesterone-mediated oocyte maturation
    100927252
   04917 Prolactin signaling pathway
    100927252
   04921 Oxytocin signaling pathway
    100927252
   04926 Relaxin signaling pathway
    100927252
   04935 Growth hormone synthesis, secretion and action
    100927252
   04919 Thyroid hormone signaling pathway
    100927252
   04916 Melanogenesis
    100927252
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100927252
  09156 Nervous system
   04725 Cholinergic synapse
    100927252
   04726 Serotonergic synapse
    100927252
   04720 Long-term potentiation
    100927252
   04730 Long-term depression
    100927252
   04722 Neurotrophin signaling pathway
    100927252
  09158 Development and regeneration
   04360 Axon guidance
    100927252
  09149 Aging
   04211 Longevity regulating pathway
    100927252
   04213 Longevity regulating pathway - multiple species
    100927252
  09159 Environmental adaptation
   04714 Thermogenesis
    100927252
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100927252
   05206 MicroRNAs in cancer
    100927252
   05205 Proteoglycans in cancer
    100927252
   05207 Chemical carcinogenesis - receptor activation
    100927252
   05208 Chemical carcinogenesis - reactive oxygen species
    100927252
   05203 Viral carcinogenesis
    100927252
   05230 Central carbon metabolism in cancer
    100927252
   05231 Choline metabolism in cancer
    100927252
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100927252
  09162 Cancer: specific types
   05210 Colorectal cancer
    100927252
   05212 Pancreatic cancer
    100927252
   05225 Hepatocellular carcinoma
    100927252
   05226 Gastric cancer
    100927252
   05214 Glioma
    100927252
   05216 Thyroid cancer
    100927252
   05221 Acute myeloid leukemia
    100927252
   05220 Chronic myeloid leukemia
    100927252
   05218 Melanoma
    100927252
   05211 Renal cell carcinoma
    100927252
   05219 Bladder cancer
    100927252
   05215 Prostate cancer
    100927252
   05213 Endometrial cancer
    100927252
   05224 Breast cancer
    100927252
   05223 Non-small cell lung cancer
    100927252
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100927252
   05170 Human immunodeficiency virus 1 infection
    100927252
   05161 Hepatitis B
    100927252
   05160 Hepatitis C
    100927252
   05163 Human cytomegalovirus infection
    100927252
   05167 Kaposi sarcoma-associated herpesvirus infection
    100927252
   05165 Human papillomavirus infection
    100927252
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100927252
   05022 Pathways of neurodegeneration - multiple diseases
    100927252
  09165 Substance dependence
   05034 Alcoholism
    100927252
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100927252
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100927252
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100927252
   01522 Endocrine resistance
    100927252
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100927252
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:shr04031]
    100927252
Membrane trafficking [BR:shr04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100927252
GTP-binding proteins [BR:shr04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100927252
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU FeoB_N RsgA_GTPase TniB
Other DBs
NCBI-GeneID: 100927252
NCBI-ProteinID: XP_031794389
LinkDB
Position
5:281880..286681
AA seq 354 aa
MTLRPPLEGKAEVGAALGEARPTCATATSGGLPTFESRSPGEEISQEISSGHCGLTKGPE
TPPLSDGFRQQADQHSGELLQTPALTGRPREEETGGGRQLEQVQIKTWVQSRRKSLKRQL
QDLGPLTPPGFPPLLQPPAPVLSTSAAAGLPYTYPGDPDRRRTKMYKLVVMGTFCVGKTA
LIMQFTKNHFMTEYGPTIQDSYRKHTVVDEEQCQLDILDTTSTEAFYCLRDESMHWGEGF
LLVYAVNDLYSFDNVNILWDRLQGIKGTNRVPVVLVANKVDVTDRLVNHTVGQEVARSFG
IPYVETSAKTGQGVEQAFHDLVREICRLRAEEELKSLPNTEQKKVWEFKFCTIQ
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgactctgagacctccgctggaagggaaggccgaggtcggcgcggccttgggggaggcc
cgacctacctgcgccaccgccacctctggaggtcttcccaccttcgaatccaggtccccg
ggcgaggaaatttctcaggagatcagcagtggccactgcggactgaccaagggcccggaa
accccgcccctttcggacggttttcgccaacaagcagatcagcactctggagagctcctc
caaacgcccgcactaactgggcgccccagagaggaggaaactggcggcgggaggcagctg
gagcaagttcagatcaaaacctgggtccaaagtcgccgcaagagtctgaaacgccagttg
caggacttggggcccctgacccctccaggcttccctccacttttacagccccctgcccca
gtgctcagcaccagcgccgccgcgggcctgccgtacacgtaccccggtgatccagacaga
cgcagaaccaagatgtataagttggtggtgatgggcaccttttgtgtgggcaagactgca
ctgatcatgcaattcactaagaatcattttatgactgaatatggccccaccatccaagat
tcctaccgtaagcacacagtggtggatgaagagcagtgccagctggacatcttggatacc
acaagcactgaagcattttattgcctaagggatgagtccatgcactggggagagggattc
ctcttagtctatgcagtgaatgacctctactcttttgacaatgtgaatatcctctgggac
cgtctacagggaatcaagggcaccaaccgtgtacccgtggtgttggtggccaacaaagta
gacgtaactgataggctggtgaaccatacagtgggccaggaggtggccaggagcttcggg
atcccttacgtggagacatcagccaagactgggcaaggtgtggagcaagccttccatgac
ttggtccgagaaatttgtaggctgcgagctgaggaggagctcaagagtctccctaatact
gagcagaagaaagtctgggagttcaagttttgcacaatccagtga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100929426
Entry
100929426         CDS       T02286                                 
Name
(RefSeq) ras protein let-60-like
  KO
K07827  GTPase KRas
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04062  Chemokine signaling pathway
shr04068  FoxO signaling pathway
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04137  Mitophagy - animal
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04218  Cellular senescence
shr04360  Axon guidance
shr04370  VEGF signaling pathway
shr04371  Apelin signaling pathway
shr04540  Gap junction
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04625  C-type lectin receptor signaling pathway
shr04650  Natural killer cell mediated cytotoxicity
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04714  Thermogenesis
shr04720  Long-term potentiation
shr04722  Neurotrophin signaling pathway
shr04725  Cholinergic synapse
shr04726  Serotonergic synapse
shr04730  Long-term depression
shr04810  Regulation of actin cytoskeleton
shr04910  Insulin signaling pathway
shr04912  GnRH signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04916  Melanogenesis
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04921  Oxytocin signaling pathway
shr04926  Relaxin signaling pathway
shr04929  GnRH secretion
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr04960  Aldosterone-regulated sodium reabsorption
shr05010  Alzheimer disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05034  Alcoholism
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05207  Chemical carcinogenesis - receptor activation
shr05208  Chemical carcinogenesis - reactive oxygen species
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05216  Thyroid cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100929426
   04012 ErbB signaling pathway
    100929426
   04014 Ras signaling pathway
    100929426
   04015 Rap1 signaling pathway
    100929426
   04370 VEGF signaling pathway
    100929426
   04371 Apelin signaling pathway
    100929426
   04068 FoxO signaling pathway
    100929426
   04072 Phospholipase D signaling pathway
    100929426
   04071 Sphingolipid signaling pathway
    100929426
   04151 PI3K-Akt signaling pathway
    100929426
   04150 mTOR signaling pathway
    100929426
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100929426
   04137 Mitophagy - animal
    100929426
  09143 Cell growth and death
   04210 Apoptosis
    100929426
   04218 Cellular senescence
    100929426
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100929426
   04550 Signaling pathways regulating pluripotency of stem cells
    100929426
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100929426
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100929426
   04650 Natural killer cell mediated cytotoxicity
    100929426
   04660 T cell receptor signaling pathway
    100929426
   04662 B cell receptor signaling pathway
    100929426
   04664 Fc epsilon RI signaling pathway
    100929426
   04062 Chemokine signaling pathway
    100929426
  09152 Endocrine system
   04910 Insulin signaling pathway
    100929426
   04929 GnRH secretion
    100929426
   04912 GnRH signaling pathway
    100929426
   04915 Estrogen signaling pathway
    100929426
   04914 Progesterone-mediated oocyte maturation
    100929426
   04917 Prolactin signaling pathway
    100929426
   04921 Oxytocin signaling pathway
    100929426
   04926 Relaxin signaling pathway
    100929426
   04935 Growth hormone synthesis, secretion and action
    100929426
   04919 Thyroid hormone signaling pathway
    100929426
   04916 Melanogenesis
    100929426
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100929426
  09156 Nervous system
   04725 Cholinergic synapse
    100929426
   04726 Serotonergic synapse
    100929426
   04720 Long-term potentiation
    100929426
   04730 Long-term depression
    100929426
   04722 Neurotrophin signaling pathway
    100929426
  09158 Development and regeneration
   04360 Axon guidance
    100929426
  09149 Aging
   04211 Longevity regulating pathway
    100929426
   04213 Longevity regulating pathway - multiple species
    100929426
  09159 Environmental adaptation
   04714 Thermogenesis
    100929426
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100929426
   05206 MicroRNAs in cancer
    100929426
   05205 Proteoglycans in cancer
    100929426
   05207 Chemical carcinogenesis - receptor activation
    100929426
   05208 Chemical carcinogenesis - reactive oxygen species
    100929426
   05203 Viral carcinogenesis
    100929426
   05230 Central carbon metabolism in cancer
    100929426
   05231 Choline metabolism in cancer
    100929426
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100929426
  09162 Cancer: specific types
   05210 Colorectal cancer
    100929426
   05212 Pancreatic cancer
    100929426
   05225 Hepatocellular carcinoma
    100929426
   05226 Gastric cancer
    100929426
   05214 Glioma
    100929426
   05216 Thyroid cancer
    100929426
   05221 Acute myeloid leukemia
    100929426
   05220 Chronic myeloid leukemia
    100929426
   05218 Melanoma
    100929426
   05211 Renal cell carcinoma
    100929426
   05219 Bladder cancer
    100929426
   05215 Prostate cancer
    100929426
   05213 Endometrial cancer
    100929426
   05224 Breast cancer
    100929426
   05223 Non-small cell lung cancer
    100929426
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100929426
   05170 Human immunodeficiency virus 1 infection
    100929426
   05161 Hepatitis B
    100929426
   05160 Hepatitis C
    100929426
   05163 Human cytomegalovirus infection
    100929426
   05167 Kaposi sarcoma-associated herpesvirus infection
    100929426
   05165 Human papillomavirus infection
    100929426
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100929426
   05022 Pathways of neurodegeneration - multiple diseases
    100929426
  09165 Substance dependence
   05034 Alcoholism
    100929426
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100929426
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100929426
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100929426
   01522 Endocrine resistance
    100929426
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100929426
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:shr04031]
    100929426
Membrane trafficking [BR:shr04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100929426
GTP-binding proteins [BR:shr04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100929426
SSDB
Motif
Pfam: Ras Roc GTP_EFTU FeoB_N RsgA_GTPase Arf MMR_HSR1
Other DBs
NCBI-GeneID: 100929426
NCBI-ProteinID: XP_031794375
Ensembl: ENSSHAG00000003773
LinkDB
Position
5:complement(114279..116042)
AA seq 208 aa
MASCVHTSIGDPDEHRLVMYKMVVMGTCYVGKSALTIQFTKNNFITQYDPTVQDFYSKDT
VVDEEPCQLDIVDSTGTEIFFSLRDQNVRWGEGFLVVYGVSDLYSFENVTILWDHVRSLK
HANRVPMVLVANKVDVTDRLVDPRQGQEVARSLGVPYVETSAKTGEGVEQAFHELVVEIR
KIRAEEEHKKLAKAKWRKTCGCKCCTIQ
NT seq 627 nt   +upstreamnt  +downstreamnt
atggcttcttgtgtccatacctccataggtgatccagatgaacacagactcgtgatgtat
aagatggtggtaatgggcacctgttatgtgggcaagagtgcattgaccattcagtttact
aagaataattttataactcaatatgaccccacagtccaagatttttacagtaaggacaca
gtggtagatgaagagccgtgccagctggacatcgtggattccacaggcactgaaatattt
ttctctctgagggaccagaatgtgcgctggggagagggcttccttgttgtctatggtgtg
agtgacctctactcttttgagaatgtgactatcctttgggaccatgtgcggagtctcaag
cacgccaatcgtgtacccatggtgttggtggccaacaaagtagacgtgaccgacaggctg
gtggaccccagacagggccaggaggtggccaggagcttaggggtcccttatgtggagacg
tcagccaagactggggaaggtgtggaacaagccttccatgagctggttgttgaaattcgt
aagatccgagctgaggaggaacacaagaaactcgctaaagctaagtggaggaagacctgt
gggtgcaagtgttgcacaatccagtga

DBGET integrated database retrieval system