Sarcophilus harrisii (Tasmanian devil): 100915548 Help Entry 100915548         CDS       T02286                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr01521   EGFR tyrosine kinase inhibitor resistance shr01524   Platinum drug resistance shr04014   Ras signaling pathway shr04064   NF-kappa B signaling pathway shr04115   p53 signaling pathway shr04137   Mitophagy - animal shr04140   Autophagy - animal shr04151   PI3K-Akt signaling pathway shr04210   Apoptosis shr04215   Apoptosis - multiple species shr04621   NOD-like receptor signaling pathway shr04630   JAK-STAT signaling pathway shr05012   Parkinson disease shr05014   Amyotrophic lateral sclerosis shr05022   Pathways of neurodegeneration - multiple diseases shr05145   Toxoplasmosis shr05162   Measles shr05166   Human T-cell leukemia virus 1 infection shr05168   Herpes simplex virus 1 infection shr05170   Human immunodeficiency virus 1 infection shr05200   Pathways in cancer shr05202   Transcriptional misregulation in cancer shr05212   Pancreatic cancer shr05220   Chronic myeloid leukemia shr05222   Small cell lung cancer shr05225   Hepatocellular carcinoma shr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100915548 (BCL2L1)    04630 JAK-STAT signaling pathway     100915548 (BCL2L1)    04064 NF-kappa B signaling pathway     100915548 (BCL2L1)    04151 PI3K-Akt signaling pathway     100915548 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100915548 (BCL2L1)    04137 Mitophagy - animal     100915548 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     100915548 (BCL2L1)    04215 Apoptosis - multiple species     100915548 (BCL2L1)    04115 p53 signaling pathway     100915548 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100915548 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100915548 (BCL2L1)    05202 Transcriptional misregulation in cancer     100915548 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     100915548 (BCL2L1)    05225 Hepatocellular carcinoma     100915548 (BCL2L1)    05220 Chronic myeloid leukemia     100915548 (BCL2L1)    05222 Small cell lung cancer     100915548 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100915548 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     100915548 (BCL2L1)    05162 Measles     100915548 (BCL2L1)    05168 Herpes simplex virus 1 infection     100915548 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100915548 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     100915548 (BCL2L1)    05014 Amyotrophic lateral sclerosis     100915548 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     100915548 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100915548 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100915548 (BCL2L1)    01524 Platinum drug resistance     100915548 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:shr01009]     100915548 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:shr03036]     100915548 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:shr02000]     100915548 (BCL2L1) Protein phosphatases and associated proteins [BR:shr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      100915548 (BCL2L1) Chromosome and associated proteins [BR:shr03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     100915548 (BCL2L1) Transporters [BR:shr02000]  Other transporters   Pores ion channels [TC:1]    100915548 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  100915548 NCBI-ProteinID:  XP_012409072 Ensembl:  ENSSHAG00000013693 UniProt:  G3WKX6 LinkDB All DBs Position 2:434110837..434158424 Genome browser AA seq 227 aa AA seqDB search MSHSNRELVVDFLSYKLSQKGYNWSQFEDENRTEASEGTEIPSTVNGSPSWHPADSRAVS GATGHSSSLDAHETIPVAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQV VNELFRDGVNWGRIVAFFSFGGALCVESVDKEMEVLVARITSWMATYLDEHLDPWIQENG GWDTFVELYGNDAAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK NT seq 684 nt NT seq  +upstreamnt  +downstreamnt atgtctcacagtaaccgggagctggtggttgactttctttcttacaagctttcacagaag ggatacaattggagtcagtttgaagatgagaacaggactgaggcctcagaagggacagag atacctagtactgtgaatggcagcccctcttggcaccctgctgacagccgtgcagtgagt ggggccacaggacacagcagcagcctggatgcccatgagacaattcctgtagctgctgtg aagcaagctttgagggaggcaggagatgaatttgaactccggtaccggcgggcattcagt gatctgacatcccagctccacatcactccagggacggcttatcagagttttgagcaggta gtgaatgaactcttccgggatggggtgaactggggccgaattgtggcattcttctccttc ggaggggcattgtgtgtggaaagcgtggataaagagatggaagtcttggtagcacgcatc acctcctggatggccacttacttggatgagcacctagacccatggatccaagaaaatggc ggttgggacaccttcgtggagctttatgggaatgatgcagcagcagagagccggaagggc caggaacgcttcaacagatggctgctgactggcatgacagtggctggtgtagtcctgctg gggtccctgttcagccggaagtga

DBGET integrated database retrieval system