Sarcophilus harrisii (Tasmanian devil): 100915663 Help Entry 100915663         CDS       T02286                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04066   HIF-1 signaling pathway shr04120   Ubiquitin mediated proteolysis shr05170   Human immunodeficiency virus 1 infection shr05200   Pathways in cancer shr05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:shr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     100915663 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     100915663 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100915663 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     100915663 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100915663 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:shr04121]     100915663 (ELOB)    03400 DNA repair and recombination proteins [BR:shr03400]     100915663 (ELOB) Ubiquitin system [BR:shr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      100915663 (ELOB)    Cul5 complex      100915663 (ELOB) DNA repair and recombination proteins [BR:shr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      100915663 (ELOB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  100915663 NCBI-ProteinID:  XP_012398591 Ensembl:  ENSSHAG00000017731 LinkDB All DBs Position 1:complement(337747701..337750409) Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDSKTLGEC GFTSQTARPQAPATVGLAFRADDVFETLRIESFSSPPELPDVMKPQDSGSGTNEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctcatgatccggcgccacaagaccacgatcttcacagatgcgaaggag tcgagcacagtgttcgagctgaagcgcattgtggaaggcatcctcaagaggcctccggat gagcagcggctctataaggatgaccagctgctggatgacagcaagaccctgggtgagtgt ggcttcacaagtcagacagccaggcctcaagcaccagccactgtggggctggcctttcga gcggatgatgtatttgaaacattgcgcattgagtctttctccagccctccagaactgcca gatgtcatgaagcctcaagactctggaagtggcaccaatgagcaagctgtgcagtaa

DBGET integrated database retrieval system