Sarcophilus harrisii (Tasmanian devil): 100915930 Help Entry 100915930         CDS       T02286                                  Name (RefSeq) histone H2AX   KO K11251   histone H2A Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr03082   ATP-dependent chromatin remodeling shr04217   Necroptosis shr04613   Neutrophil extracellular trap formation shr05034   Alcoholism shr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:shr00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100915930  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100915930  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100915930  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     100915930   09165 Substance dependence    05034 Alcoholism     100915930  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:shr03036]     100915930   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shr04147]     100915930 Chromosome and associated proteins [BR:shr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100915930 Exosome [BR:shr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100915930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF DLIC Motif Other DBs NCBI-GeneID:  100915930 NCBI-ProteinID:  XP_012400425 Ensembl:  ENSSHAG00000010034 UniProt:  G3W8C9 LinkDB All DBs Position 3:complement(358839824..358841069) Genome browser AA seq 145 aa AA seqDB search MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK SGAIAGPKAPGSGGSKKSTQASQEY NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgtcgggtcgcggcaagaccggcgggaaggcccgcgccaaggccaagtctcgctcttcg cgggccgggctgcagttccccgtgggccgtgtgcaccgcctgctgaggaaaggccactac gcggagcgagtcggagccggcgcgccggtgtacctggcggcggtgctggagtacctgacg gccgagatcctggagctggccggcaacgcggcccgggacaacaagaagacccgcatcatc ccccgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcggc gtgaccatcgcccagggcggcgtcctgcccaacatccaggcggtgctgctgcccaagaag agcggcgccatcgccggccccaaggccccgggcagcggcggcagcaagaagagcacgcag gcctcgcaggagtactga

DBGET integrated database retrieval system